PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07793g02010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 183aa    MW: 20024.7 Da    PI: 8.365
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07793g02010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.61.2e-44111101100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+
  Niben101Scf07793g02010.1  11 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFINVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQR 95 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+e+l++el+++++e
  Niben101Scf07793g02010.1  96 QVERLQKELDAANAE 110
                               *********999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.77710111IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4311108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MASSSSSYNS PCAACKFLRR KCLPGCIFAP YFPPEEPQKF INVHKIFGAS NVTKLLNELL  60
PHQREDAVNS LAYEAEARVR DPVYGCVGAI SFLQRQVERL QKELDAANAE LIRYACNEYT  120
PPPPLPGTQG INMAAFRPRP VEFSRGFHQT PSFPIPYSIP NNWNVQNSSA GNIHGGGGGG  180
ASI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6821182118LOB family transfactor Ramosa2.1
5ly0_B2e-6821182118LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779904.11e-119PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML47e-73LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A1U7WYZ91e-118A0A1U7WYZ9_NICSY; protein LATERAL ORGAN BOUNDARIES-like
STRINGXP_009779904.11e-119(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-72LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]