PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07764g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 418aa    MW: 47585.6 Da    PI: 8.4023
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07764g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.4e-50401661128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                               + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWk
  Niben101Scf07764g00002.1  40 MFPGFRFCPTDEELISYYLKKKVEGSDRCV-EVISEVEIWKHEPWDLPdKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWK 123
                               579************************777.99***************778888999**************************** PP

                       NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               atgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey +
  Niben101Scf07764g00002.1 124 ATGKKRNVKS-GSNMIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 166
                               **********.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5637183IPR003441NAC domain
PROSITE profilePS5100553.80540184IPR003441NAC domain
PfamPF023659.4E-2742165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MEDVSGSTDE KKGREIVERS ENNGNDDKNV EISVATASTM FPGFRFCPTD EELISYYLKK  60
KVEGSDRCVE VISEVEIWKH EPWDLPDKSI VQSDNEWFFF SPRGRKYPNG SQSKRATESG  120
YWKATGKKRN VKSGSNMIGT KRTLVFHTGR APKGQRTQWI MHEYCMTGNS YYQDSVVVCR  180
LRKNNEFHLN DTHENRRNHL GNDCATALSG AGKLNSLELI NGGDCCSKEG SSSFSSHSVE  240
KIESGSDSDK LTKELPQQQS SSQWKDCDEE DCFADIMKDD IVKLDDSSYK ARYNVLPIAN  300
RKLESSTNSS TQEFQDVMSH RLPFQGTANR RLRLQTEIVP RRVGRYEANK KNGHAVDASR  360
HLRNNIIPVR RIKQWSIPLL LVSLALLVIF LCMFGIPHLK WLRHLLVITP AEVDTRPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-44311858166NO APICAL MERISTEM PROTEIN
1ut4_B8e-44311858166NO APICAL MERISTEM PROTEIN
1ut7_A8e-44311858166NO APICAL MERISTEM PROTEIN
1ut7_B8e-44311858166NO APICAL MERISTEM PROTEIN
3swm_A9e-443118511169NAC domain-containing protein 19
3swm_B9e-443118511169NAC domain-containing protein 19
3swm_C9e-443118511169NAC domain-containing protein 19
3swm_D9e-443118511169NAC domain-containing protein 19
3swp_A9e-443118511169NAC domain-containing protein 19
3swp_B9e-443118511169NAC domain-containing protein 19
3swp_C9e-443118511169NAC domain-containing protein 19
3swp_D9e-443118511169NAC domain-containing protein 19
4dul_A8e-44311858166NAC domain-containing protein 19
4dul_B8e-44311858166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019250218.10.0PREDICTED: NAC domain-containing protein 40-like
TrEMBLA0A1J6IT190.0A0A1J6IT19_NICAT; Nac domain-containing protein 60
STRINGXP_009787917.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.13e-83NAC domain containing protein 60