PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07355g01004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 145aa    MW: 16633.1 Da    PI: 7.7179
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07355g01004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601231.5e-3851051101
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk lrr+C++dC++ pyfp ++p++f +vh+++Gasnv k+l +++e++r d++++l+yeA +r++dPvyG+vg+i+ l++
  Niben101Scf07355g01004.1   5 RCAACKQLRRRCPSDCIFLPYFPPNNPQRFSCVHRIYGASNVGKMLLQVQEHQRADVADTLYYEAYCRIKDPVYGCVGIITVLHE 89 
                               6************************************************************************************ PP

                    DUF260  86 qleqlkaelallkeel 101
                               ++ ql+ +la++++e+
  Niben101Scf07355g01004.1  90 EIYQLQCQLAKVQAEI 105
                               ***********99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0284105IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-385102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MTSTRCAACK QLRRRCPSDC IFLPYFPPNN PQRFSCVHRI YGASNVGKML LQVQEHQRAD  60
VADTLYYEAY CRIKDPVYGC VGIITVLHEE IYQLQCQLAK VQAEIDLLKA QSPVQGQQEV  120
EFSAKLLADQ NGLLSSFHPS FHWFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-35610512111LOB family transfactor Ramosa2.1
5ly0_B1e-35610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019238658.11e-93PREDICTED: LOB domain-containing protein 24-like
SwissprotP594681e-46LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1J6KI982e-92A0A1J6KI98_NICAT; Lob domain-containing protein 24
STRINGXP_009589427.12e-91(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-49LOB domain-containing protein 24