PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07275g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 245aa    MW: 27928.2 Da    PI: 8.1324
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07275g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14e-201978357
                              --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                              +R+++tkeq++ Le+++++  r+psae++++++ +l    +++ ++V++WFqN++a++++
  Niben101Scf07275g02001.1 19 SRWNPTKEQIDLLESVYRQgIRTPSAEQIQQITLRLrafgHIEGKNVFYWFQNHKARQRQ 78
                              6*****************99**************************************97 PP

2Wus_type_Homeobox113.11.4e-361880365
         Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                               +RW+Pt+eQi +Le++y++G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
  Niben101Scf07275g02001.1 18 GSRWNPTKEQIDLLESVYRQGIRTPSAEQIQQITLRLRAFGHIEGKNVFYWFQNHKARQRQKQ 80
                              58***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6891479IPR001356Homeobox domain
SMARTSM003891.3E-41683IPR001356Homeobox domain
SuperFamilySSF466893.04E-121783IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-81978IPR009057Homeodomain-like
PfamPF000467.7E-181978IPR001356Homeobox domain
CDDcd000869.99E-72080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSDDNNSVEM LASETPVGSR WNPTKEQIDL LESVYRQGIR TPSAEQIQQI TLRLRAFGHI  60
EGKNVFYWFQ NHKARQRQKQ KQDKFAYFNR FLHRTNVFPP PRPNVVCSPY YTPQNNLGFY  120
QQYPVSSLIL PGPGCFKRRA TCDAAVYINA THSLENSNNM AHFSPNEKQF NHQETLNLFP  180
LHPTGILLEK TTSSSPSADD QSTIPSNYTP TNFVEANCFT DLGIGAGDHQ VFNFLCGKGP  240
CERQY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758504.11e-172PREDICTED: WUSCHEL-related homeobox 2
RefseqXP_016513970.11e-172PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLA0A1J6IBB81e-171A0A1J6IBB8_NICAT; Wuschel-related homeobox 2
STRINGXP_009758504.11e-171(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-40WUSCHEL related homeobox 2