PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07231g03006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 321aa    MW: 36720.7 Da    PI: 8.7754
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07231g03006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.53.6e-55181441129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL kkv ++++    +i evd++kvePwdLp k+k +ekewyfF+ rdkky+tg r+nrat++gyWka
  Niben101Scf07231g03006.1  18 LPPGFRFHPTDEELITHYLSKKVVDNNFLP-IAIGEVDMNKVEPWDLPWKAKMGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKA 101
                               79***********************99655.58***************888999******************************* PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               tgkdke+++ +++lvg+kktLvfy+grapkgekt+Wv+heyrle
  Niben101Scf07231g03006.1 102 TGKDKEIFR-GKSLVGMKKTLVFYRGRAPKGEKTNWVIHEYRLE 144
                               *********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-6215169IPR003441NAC domain
PROSITE profilePS5100557.78418169IPR003441NAC domain
PfamPF023657.9E-2919143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MENFVGPVVK EEDQQLQLPP GFRFHPTDEE LITHYLSKKV VDNNFLPIAI GEVDMNKVEP  60
WDLPWKAKMG EKEWYFFCVR DKKYPTGLRT NRATAAGYWK ATGKDKEIFR GKSLVGMKKT  120
LVFYRGRAPK GEKTNWVIHE YRLEGRLSLQ NLPKTTKQND WVISRVFYKS TGGNKVHISG  180
LMRLNSTETE MGNSILPTLS DSESSHVHCF SNFVTAQKSQ NEMTNYFNNC SIPSLPNKFA  240
LNPTLPPQDT LLNPGSFPMQ DPPRLRNLYQ NYGQNMVQNL KEEKEIVSVS QETGVSTHMN  300
NEFSSSAAVV GPQYLDYLCN Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-5491756171NO APICAL MERISTEM PROTEIN
1ut4_B3e-5491756171NO APICAL MERISTEM PROTEIN
1ut7_A3e-5491756171NO APICAL MERISTEM PROTEIN
1ut7_B3e-5491756171NO APICAL MERISTEM PROTEIN
3swm_A3e-5491759174NAC domain-containing protein 19
3swm_B3e-5491759174NAC domain-containing protein 19
3swm_C3e-5491759174NAC domain-containing protein 19
3swm_D3e-5491759174NAC domain-containing protein 19
3swp_A3e-5491759174NAC domain-containing protein 19
3swp_B3e-5491759174NAC domain-containing protein 19
3swp_C3e-5491759174NAC domain-containing protein 19
3swp_D3e-5491759174NAC domain-containing protein 19
4dul_A3e-5491756171NAC domain-containing protein 19
4dul_B3e-5491756171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019258047.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
SwissprotQ9FLJ21e-115NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A314LGQ00.0A0A314LGQ0_NICAT; Nac domain-containing protein 100
STRINGXP_009803819.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-118NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]