PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07162g05018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 185aa    MW: 21712.5 Da    PI: 6.2662
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07162g05018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM30.88.3e-10158360128
                       NAM  60 fFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                F  +++k++t  r +r+ + g+Wk +    ++++ kg++vg ++ + f + +++  ++  W+m ey++
  Niben101Scf07162g05018.1  15 VFLYKQEKETTIXRVRRTCAYGTWKGQTGIDPIKKGKGTVVGFRRCFKFQSRSKEGEHNKIWLMREYSV 83 
                               58889999999**************8888899**99*************977777777888******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100514.7351106IPR003441NAC domain
SuperFamilySSF1019413.01E-1415105IPR003441NAC domain
PfamPF023657.9E-52983IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
LVFAYCGNYY CLVLVFLYKQ EKETTIXRVR RTCAYGTWKG QTGIDPIKKG KGTVVGFRRC  60
FKFQSRSKEG EHNKIWLMRE YSVGDDFFRE NNIPKEDIVV CRIKKNIRSK KNHGVNMEEQ  120
DVPQVIEAML RGPDEDYCTT VQPETICQAA DQHQVNDWSN YQQEFNWADD MLIGIDEFGD  180
IIWIL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019265102.11e-105PREDICTED: NAC domain-containing protein 78-like
TrEMBLB3VK721e-103B3VK72_TOBAC; NAC transcription factor
STRINGXP_009770806.11e-104(Nicotiana sylvestris)
STRINGXP_009793650.11e-103(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.32e-07NAC family protein