PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07028g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 204aa    MW: 22225.3 Da    PI: 7.3109
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07028g01001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-41411401100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FG+sn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+
  Niben101Scf07028g01001.1  41 PCAACKILRRRCAEKCVLAPYFPPSDPIKFTTAHRVFGTSNIIKFLQELPEFQRADAVSSMVYEANARLRDPVYGCAGAICHLQK 125
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q++ l+++la++++e
  Niben101Scf07028g01001.1 126 QVNGLQVQLAKAQAE 140
                               ***********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.55840141IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4141138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MESSDITATT ITSPISSRSV SPSSASRPNS PTPLQVVIVS PCAACKILRR RCAEKCVLAP  60
YFPPSDPIKF TTAHRVFGTS NIIKFLQELP EFQRADAVSS MVYEANARLR DPVYGCAGAI  120
CHLQKQVNGL QVQLAKAQAE IVNMQCEQTN LMAHICMEMT QSAQASPQHY SLGNFTSLTN  180
GSSQSNTSFL DDNSFGSFPE TLWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-424014810118LOB family transfactor Ramosa2.1
5ly0_B4e-424014810118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610820.11e-120PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016509518.11e-120PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-67LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4D8501e-119A0A1S4D850_TOBAC; LOB domain-containing protein 1-like
STRINGXP_009610820.11e-120(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-69LOB domain-containing protein 1