PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06986g02003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 161aa    MW: 17750.9 Da    PI: 8.2051
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06986g02003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.5e-4211109199
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC ++C++apyfp e+p kf  vhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+
  Niben101Scf06986g02003.1  11 PCAACKFLRRKCLPSCIFAPYFPPEEPIKFTTVHKVFGASNVSKLLNEIQPHQREDAVNSLTYEAEARLKDPVYGCVGAISVLQK 95 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallke 99 
                               q+ +l++el+++++
  Niben101Scf06986g02003.1  96 QVIRLQKELDATNA 109
                               *********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.01210111IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4211108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSSSSSYSNP PCAACKFLRR KCLPSCIFAP YFPPEEPIKF TTVHKVFGAS NVSKLLNEIQ  60
PHQREDAVNS LTYEAEARLK DPVYGCVGAI SVLQKQVIRL QKELDATNAD LMRYASYESR  120
GGTGTLIGQT YGMFGPRHSS AWNSRINSGD HNNGIDDDSG R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-631112711126LOB family transfactor Ramosa2.1
5ly0_B9e-631112711126LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019226510.11e-111PREDICTED: LOB domain-containing protein 25-like
RefseqXP_019226511.11e-111PREDICTED: LOB domain-containing protein 25-like
RefseqXP_019226512.11e-111PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q32e-66LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A314KRS41e-109A0A314KRS4_NICAT; Lob domain-containing protein 25
STRINGXP_009757880.11e-97(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.19e-67LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]