PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06942g01004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 363aa    MW: 40988.8 Da    PI: 6.8573
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06942g01004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26054.82.8e-1724129348100
                    DUF260  48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                               +lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++e
  Niben101Scf06942g01004.1 241 ELPVQQRADAVSSLVYEANARVRDPVYGCVGAISLLQNQVSQLQMQLAVAQAE 293
                               68999*******************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.0E-15241291IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042138Biological Processmeiotic DNA double-strand break formation
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MSIAVSQISL FQSQIESRRF NEGTIRVLES FLALNDFKSL DGVVRTLKQF MRNESLCIIQ  60
EIAGKSTEHK LLIVDFLVRV FALIGDTESC LALRYEALLM REQKATSDQR LLVLYSEWLT  120
FAEHSLENGF CSIAKKACEK ALLCFEMNIV IDPGKDDFVI EKIKKLKDIA VISASSRSVQ  180
AQAVEYFKKK TILQTSQESY TSVEAKSSGS TLFRNGIKRR HRRQLDEHRH LEQNEEVSGD  240
ELPVQQRADA VSSLVYEANA RVRDPVYGCV GAISLLQNQV SQLQMQLAVA QAEILCIQMQ  300
QEPVPSLPTT CLMEPHIEKS SPFSTSNATN YNFNNNLQSY LSFTSSSTSH VMQDPVKRES  360
LRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-1724029557112LOB family transfactor Ramosa2.1
5ly0_B2e-1724029557112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019225529.11e-163PREDICTED: uncharacterized protein LOC109207098 isoform X3
TrEMBLA0A1S4C2U41e-160A0A1S4C2U4_TOBAC; uncharacterized protein LOC107814565 isoform X3
TrEMBLA0A1S4C3481e-160A0A1S4C348_TOBAC; uncharacterized protein LOC107814565 isoform X1
TrEMBLA0A1U7V2601e-160A0A1U7V260_NICSY; uncharacterized protein LOC104212821 isoform X2
STRINGXP_009760472.11e-153(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-34LBD family protein