PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06869g03007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 643aa    MW: 71120.7 Da    PI: 7.0459
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06869g03007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.83.4e-2964147186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW++qe+laL+++r+em+  +r+++lk+plWeevs+k+++ g++rs+k+Ckek+en+ k+++++k+g+ ++++++  ++++fdql
  Niben101Scf06869g03007.1  64 RWPRQETLALLRIRSEMDVVFRDSSLKGPLWEEVSRKLADLGYHRSAKKCKEKFENVYKYHRRTKDGRASKADGK--SYRFFDQL 146
                               8********************************************************************975555..5******9 PP

                  trihelix  86 e 86 
                                
  Niben101Scf06869g03007.1 147 A 147
                               6 PP

2trihelix1032.3e-32448533187
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW+k+e+ aLi++r++++ +++++  k+plWee+s+ m + g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql
  Niben101Scf06869g03007.1 448 RWPKEEIEALIRLRTSLDLKYQDNGPKGPLWEEISAGMLKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQL 531
                               8*********************************************************************8.99*********** PP

                  trihelix  86 ea 87 
                               ea
  Niben101Scf06869g03007.1 532 EA 533
                               85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.1257121IPR017877Myb-like domain
SMARTSM007170.002361123IPR001005SANT/Myb domain
CDDcd122032.56E-2463128No hitNo description
PfamPF138372.0E-1863148No hitNo description
SMARTSM007173.0E-5445507IPR001005SANT/Myb domain
CDDcd122035.01E-28447512No hitNo description
PROSITE profilePS500907.689447505IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.5E-4447504IPR009057Homeodomain-like
PfamPF138373.2E-22447534No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MLGVSSGLMT TTSGGGGAAS ISAAPPPPQE APESGGSSEG GGGGDVAAAG GFSEEGERNS  60
GGNRWPRQET LALLRIRSEM DVVFRDSSLK GPLWEEVSRK LADLGYHRSA KKCKEKFENV  120
YKYHRRTKDG RASKADGKSY RFFDQLAAFE NTSSHTCLPP PPLAATPLTM AMPVRPNSSA  180
NPPIPMSENI FTVSRNNVVT AAAAAVPTVH HPLNASSLPL SQPPPPPTQP IITTVNQINR  240
PQGNTSSLLS NSTSSSSTSS DEDIQKRHGK KRKWKDFFER LTKDMIEKQE ELQKKFLETL  300
EKRERERMVR EETWRVQEMT RMNREHDLLV QERSMAAAKD ATIIAFLQKM TEQKNTPIPN  360
ITNASLAQIQ FQLSEKPQSA PPHSQPQNQT QQPAPAPTPA PAPAVSLPMT IHAQVQTQAP  420
SLPVAKTFEA PIKTDNGGEN FSPASSSRWP KEEIEALIRL RTSLDLKYQD NGPKGPLWEE  480
ISAGMLKLGY NRNAKRCKEK WENINKYFKK VKESNKKRPE DSKTCPYFHQ LEALYREKAK  540
NEVVPNIGTG FGLKPENNNP MVPIMAEPEQ QWPFPSIQPQ HQHQHQQEGI MSSIIQDHDN  600
ESDSMEEDDY DDDEDEGNAY EIVTNKQPSS MAAATATAAT TAV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264272QKRHGKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019260392.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-137TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A314LDF20.0A0A314LDF2_NICAT; Trihelix transcription factor gt-2
STRINGXP_009594163.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-71Trihelix family protein