PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06867g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 327aa    MW: 37161.7 Da    PI: 7.3572
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06867g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42231221100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lq+
  Niben101Scf06867g03002.1  23 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKIFGASNVAKLLNELNAAQREDAVNSLAYEAEYRLRDPVYGCVGLISLLQH 107
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               +l+q++ +l  +k+e
  Niben101Scf06867g03002.1 108 KLRQVQDDLLNAKKE 122
                               ********9888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7122123IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4223119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MLSINGLQLL YNRNQRMSSS NSPCAACKFL RRKCTQECVF APYFPPDQPQ KFANVHKIFG  60
ASNVAKLLNE LNAAQREDAV NSLAYEAEYR LRDPVYGCVG LISLLQHKLR QVQDDLLNAK  120
KELETYIGPS AMLPIFQPQG FLQPHHMNNP SSSTMMPFNM NPMLGMPTGV PHGGQLMIRD  180
PQQQQQQTIE AQQLAAAMAA REQSEQQEML RNYEQQQQHP QQQDIVRFNS RFDSTGSVTA  240
TGFHQMNSSP ISASLALGSY ENNPYNLIQQ QQPQQQEQNH PHHQQIHLQP QLLLQQQQHQ  300
TPQQPETPRQ QQRAKSEEEG RNVGPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-48191267114LOB family transfactor Ramosa2.1
5ly0_B5e-48191267114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792980.11e-170PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016501970.11e-170PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ35e-84LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A1S4CLH71e-169A0A1S4CLH7_TOBAC; LOB domain-containing protein 36-like
TrEMBLA0A1U7Y2I11e-169A0A1U7Y2I1_NICSY; LOB domain-containing protein 36-like
STRINGXP_009792980.11e-169(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.19e-79ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]