PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06757g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 1044aa    MW: 118997 Da    PI: 5.2006
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06757g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.1e-5661331128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               lppGfrFhPtdeelv +yLk+k++gkk+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyW
  Niben101Scf06757g00006.1   6 LPPGFRFHPTDEELVAYYLKRKINGKKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYW 89 
                               79****************************.99***************6434555777*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               katgkd++v s + + vg+kktLv+y+grap+g +tdWvmheyrl
  Niben101Scf06757g00006.1  90 KATGKDRKVNS-QMRSVGMKKTLVYYRGRAPHGARTDWVMHEYRL 133
                               ***********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-624155IPR003441NAC domain
PROSITE profilePS5100561.0796156IPR003441NAC domain
PfamPF023651.1E-297133IPR003441NAC domain
SuperFamilySSF538079.81E-58381002No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1044 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING KKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QMRSVGMKKT LVYYRGRAPH  120
GARTDWVMHE YRLDERECEV SNGLQDAYAL CRVIKRSLND PKTGDVHYGS DRSSSIEIYS  180
EGRCDHHDME IRSEDYAMPP SSSSSSMAAH GSPMTGVATP TLSDDKWMQY LSNEAFSFNN  240
STHPIPNYGT LPYPPSKVNI ALECARLQHS LTLPPLEIQD FPQVGYVDIK VPQSSFTQST  300
NQTDIVEEIL SVAQASQNLI NQDSSWGGNS CAPVDNFSFL PPNNNQIHDL DSFHFIEQLK  360
EDQNVRSIDI GDFCVLDFKS DRMVENLRWI GMSDRDLEKT FLEDYQTVPI ENISAVQREE  420
NQFQGEYSIH HNSLNGFNAT ETDNFSIGFG NDNLLDDGDM TDCLSNSPSF EIYEKIEVNH  480
GFYIATRQAA KTFYHQVTPS TTLRIHRNLV TVHDLPIYIG KRLDSTAVVP KERFDNLIKK  540
VTRSWTTTMR TLVGMVALLH TFLWICFGEC LDEKGSKLEA KRGVSVNREC LMERYEKKEA  600
QDYKWDYCYK QNKFPIADKE EAKYCNVAVE NKWRYLTLVV PIDSTVGLLD LCLQIFLVLL  660
WCIHTLEFLE LASAATPKVK VGNISKVEDA SYFRIYYGQT FKVIKNTLDG KSYLLIQNNT  720
RMASRTKYCT SRIKSFVIPL ANYSIETDYY FPGTILTTST FPLNKLYMFF LYLLGMLGNL  780
KGITSTYVTS QCVLKLYQDG QIESINKSEP QQLAQYAAHF IANTDETQPC NFATFVPIEW  840
IKYLGVFANL ENRANQVYDA IKENYLCLSK SATSKTSVKP TVSWMEYKDF VEDAGGVNVD  900
DSINRITYNM SIPDDLEEFH AILCTVDVVI DDTYTSDPAV YNASTFLGNI NLEDQSCFAF  960
LSNQSLWRYD KRVQNSTVLD WYDGAVSQPQ LVLADIIEAL YPTGNYNTTY FRNIAKGEGI  1020
ISIRPEMCER DGSIAVEPTV VACQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-55213311140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019265207.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLA0A314L4810.0A0A314L481_NICAT; Nac domain-containing protein 45
STRINGSolyc02g081270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-141NAC domain containing protein 28