PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06588g01002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 94aa    MW: 10688.3 Da    PI: 9.8099
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06588g01002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM61.62.4e-19957251
                       NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
                              ppGfrFhPtdeelvv+yLkkkv++ +l++ ++i+ev++yk++Pw+Lp+++
  Niben101Scf06588g01002.1  9 PPGFRFHPTDEELVVYYLKKKVASAPLPV-TIIAEVNLYKFDPWELPSQF 57
                              8****************************.89**************9544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-27685IPR003441NAC domain
PROSITE profilePS5100520.443894IPR003441NAC domain
PfamPF023652.9E-9951IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSGSNHLQPP GFRFHPTDEE LVVYYLKKKV ASAPLPVTII AEVNLYKFDP WELPSQFGGA  60
RMGKPPKGIK SNWVMHEYRL VDNNTSLTNK CSLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-2198016140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019259450.14e-43PREDICTED: NAC transcription factor 25-like
SwissprotA2YMR06e-31NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A314LDU59e-42A0A314LDU5_NICAT; Nac transcription factor 25
STRINGXP_009780447.13e-42(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-30NAC domain containing protein 25