PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06408g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 215aa    MW: 25816.5 Da    PI: 8.0048
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06408g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix68.31.6e-212721386
                  trihelix 13 arremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                              +r em++++ ++k++k lWe ++ km+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l 
  Niben101Scf06408g02001.1  2 IRGEMDQNFMETKRNKLLWEVIATKMKEKGYNRSAEQCKCKWKNLVTRYKGCETMEAEA--L-RQQFPLYNELA 72
                              799******************************************************95..3.45799999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122035.58E-18154No hitNo description
PfamPF138371.0E-16274No hitNo description
PROSITE profilePS500906.086547IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MIRGEMDQNF METKRNKLLW EVIATKMKEK GYNRSAEQCK CKWKNLVTRY KGCETMEAEA  60
LRQQFPLYNE LAAIFMDRML RMEAEEDEND EDSEGEKDSN KKKRKLKGNT GSSSNVSSGN  120
LVGNLKEILD EFMKKQMEME MQLQKEYERR EEERKIKEME WRQKMGALQN ERLMMEKIWR  180
EREEQWKMRK EGRAEKRDAL ITALLNKLRS EDASD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100105KKKRKL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269|PubMed:15310827}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269|PubMed:15310827}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464713.11e-110PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804507e-49TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A1S3ZKD61e-108A0A1S3ZKD6_TOBAC; trihelix transcription factor GT-3b-like
STRINGXP_009768581.11e-109(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-39Trihelix family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]