PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06223g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 270aa    MW: 31482.5 Da    PI: 4.5836
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06223g00023.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM72.97.9e-2351255128
                       NAM   5 frFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                               +rF+P+d el+++ L k v+gk l++ee i  +d+y+ ePw+L    ++++k  yf ++ ++k+++++r nr+t sg W ++ k 
  Niben101Scf06223g00023.1   5 VRFRPSDIELIMQ-LLKYVAGKCLPTEELIVFADVYSKEPWQLIG--DTSKKTHYFLTQLKHKKPSDDRFNRTTCSGSWIQQDKG 86 
                               8**********77.667899999999999**************73..34667889999*************************** PP

                       NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                               ++++++ ++   g k++L + ++++p+  + +W+++ey l
  Niben101Scf06223g00023.1  87 QKIHDEdDNLISGYKRSLNYKNKKDPS-LNGRWMIKEYFL 125
                               *****9444558********9777777.89********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.6281148IPR003441NAC domain
PfamPF023651.1E-104124IPR003441NAC domain
SuperFamilySSF1019414.71E-245147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MENNVRFRPS DIELIMQLLK YVAGKCLPTE ELIVFADVYS KEPWQLIGDT SKKTHYFLTQ  60
LKHKKPSDDR FNRTTCSGSW IQQDKGQKIH DEDDNLISGY KRSLNYKNKK DPSLNGRWMI  120
KEYFLADSLL QLKSKEAKEF VICAIKKNPR SEVRGNNVAT DIEYKRFIDR VFQEGVFLQT  180
SPSEQSTMML SDNSPVMLES TSTDFFPVEK LEQNDGMLVL ENRIDCDEFF GMLNVENQEC  240
YIQEGDEVEF DWNSILDFGD HGLEENCLLY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009623547.11e-144PREDICTED: NAC transcription factor 56-like
TrEMBLA0A1S4B1S61e-141A0A1S4B1S6_TOBAC; NAC transcription factor 56-like
STRINGXP_009623547.11e-143(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9815725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.13e-14NAC domain containing protein 41