PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06155g01012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 208aa    MW: 22771.9 Da    PI: 4.8062
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06155g01012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.2e-43551541100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpee+reda++s+vyeA+ar+rdPvyG++gvi  lq+
  Niben101Scf06155g01012.1  55 PCAACKILRRRCVDKCVLAPYFPPTDPLKFTIAHRVFGASNIIKMLQELPEEQREDAVNSMVYEANARIRDPVYGCAGVICLLQK 139
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+++l+ae a++++e
  Niben101Scf06155g01012.1 140 QINELQAEFAKAQAE 154
                               ***********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.52154155IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4355152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MECSNNKTTI SSLSSGSMNS PNIVSATTTS SGLISPKSIL SAPPSQPSSP VILTPCAACK  60
ILRRRCVDKC VLAPYFPPTD PLKFTIAHRV FGASNIIKML QELPEEQRED AVNSMVYEAN  120
ARIRDPVYGC AGVICLLQKQ INELQAEFAK AQAEILNLKC QNSNLLALVC MEVSEYQENS  180
SNSNDYGNNT SLFLEDNSLY AAWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-46451601116LOB family transfactor Ramosa2.1
5ly0_B4e-46451601116LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019253003.11e-135PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1J6I4S11e-133A0A1J6I4S1_NICAT; Lob domain-containing protein 1
STRINGXP_009611728.11e-125(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-74LOB domain-containing protein 1