PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06154g01005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Whirly
Protein Properties Length: 233aa    MW: 25952.8 Da    PI: 10.9669
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06154g01005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly173.74e-54631951139
                    Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgs 85 
                               sv+k+kaal+ ++++ptf++ldsg +kl+r+G ++l++ ++++erkydWek+q falsatev++l+++++++sceffhdp++ +s
  Niben101Scf06154g01005.1  63 SVFKGKAALSAEPRLPTFSKLDSGGVKLNRRGVIMLTFWPSVGERKYDWEKRQLFALSATEVGSLISIGTRDSCEFFHDPSMLSS 147
                               79*********************************************************************************** PP

                    Whirly  86 neGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                               n+G+vrk+l+ +P +dG+G+     v+n+ +k n++f+vPv+ aefav+r++++
  Niben101Scf06154g01005.1 148 NAGQVRKSLSFKPNADGTGV-----VNNN-LKNNNRFTVPVTTAEFAVMRTAFS 195
                               *******************6.....4444.78899****************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.3E-6851213IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.22E-5956220IPR009044ssDNA-binding transcriptional regulator
PfamPF085367.7E-5264192IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAILKLAGLL RPRNQLLHKR LPGEGVRDSI WQHAINTLAG FSTVRQRIVA DGKLTGRVFA  60
PYSVFKGKAA LSAEPRLPTF SKLDSGGVKL NRRGVIMLTF WPSVGERKYD WEKRQLFALS  120
ATEVGSLISI GTRDSCEFFH DPSMLSSNAG QVRKSLSFKP NADGTGVVNN NLKNNNRFTV  180
PVTTAEFAVM RTAFSFALPH IMGWDRFTNQ PSESISQTPS KVVPQLMETE WDR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1l_A1e-106522135172protein StWhy2
3n1k_A1e-106522135172protein StWhy2
3n1j_A1e-106522135172Protein StWhy2
3n1i_A1e-106522135172protein StWhy2
3n1h_A1e-106522135172StWhy2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016508346.11e-167PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X4
SwissprotD9J0341e-151WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLA0A0V0HNQ11e-148A0A0V0HNQ1_SOLCH; Putative single-stranded DNA-bindig protein WHY2, mitochondrial-like
STRINGSolyc11g044750.1.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-80WHIRLY 2