PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06087g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 501aa    MW: 57224.4 Da    PI: 8.3156
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06087g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.73.6e-2964147186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW+++e+laL+++r++m+ ++r+++lk+plW+e+s+km e g++r++k+C+ek+en+ k++k++k+g+++r  ++ +++++f+ql
  Niben101Scf06087g06001.1  64 RWPRDETLALLKIRSQMDLAFRDSNLKGPLWDEISRKMGELGYNRNAKKCREKFENIYKYHKRTKDGRSGR--QTGKNYRFFEQL 146
                               8********************************************************************97..56668******9 PP

                  trihelix  86 e 86 
                               e
  Niben101Scf06087g06001.1 147 E 147
                               7 PP

2trihelix94.11.4e-29362447186
                  trihelix   1 rWtkqevlaLiearremeerlrr.gklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdq 84 
                               rW+k+ev aLi++r++++ ++++ g+ k+plWe++s  m++ g+ r++k+Ckekwen+nk+y+++ke++k+r +e+s+tcpyf+ 
  Niben101Scf06087g06001.1 362 RWPKSEVEALIKLRTNIDLEYQDnGSPKGPLWEDISTGMKKLGYDRNAKRCKEKWENINKYYRRVKESQKRR-PEDSKTCPYFHL 445
                               8*********************7489********************************************97.9**********9 PP

                  trihelix  85 le 86 
                               l+
  Niben101Scf06087g06001.1 446 LD 447
                               87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.3E-561123IPR001005SANT/Myb domain
PROSITE profilePS500907.20163121IPR017877Myb-like domain
CDDcd122033.86E-2363128No hitNo description
PfamPF138371.3E-1963147No hitNo description
SMARTSM007170.091359422IPR001005SANT/Myb domain
PfamPF138373.1E-22361449No hitNo description
PROSITE profilePS500907.004362420IPR017877Myb-like domain
CDDcd122035.00E-22362427No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MLETSVLLEN SATAVAGGAA VTQVVELRND GVGGGGSVGG GSEEEERSRG ELEGEKNNIS  60
GGNRWPRDET LALLKIRSQM DLAFRDSNLK GPLWDEISRK MGELGYNRNA KKCREKFENI  120
YKYHKRTKDG RSGRQTGKNY RFFEQLELLD NQINRMDTTT SISMPVPMPM PMTMIKPATS  180
GCQNFTYRNQ GVNPEFMSMS TSTTSSSGKE SDGSVKKKRK LAGYFERLMK QVLDKQEDLQ  240
NKFLEAIEKC EGDRIEREEA WKMQEIARLK KEKEALANER AISAAKDAAV IAFLQKISEQ  300
TVQVQSPMEL SHEKMTENSS VKTVESQENV LQQDDDKQEN MLDKQDIIDS AGENSFHMSS  360
CRWPKSEVEA LIKLRTNIDL EYQDNGSPKG PLWEDISTGM KKLGYDRNAK RCKEKWENIN  420
KYYRRVKESQ KRRPEDSKTC PYFHLLDSIY QNKSKKQLLS SENPGSSIKA GELLMQIMNR  480
QQQQQQLETE NIQRQNVERS Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215220KKKRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626647.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLA0A1S3Z0J00.0A0A1S3Z0J0_TOBAC; trihelix transcription factor GT-2-like
TrEMBLA0A1U7VX140.0A0A1U7VX14_NICSY; trihelix transcription factor GT-2-like
STRINGXP_009626647.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97942328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.15e-71Trihelix family protein