PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05937g02016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 683aa    MW: 75964.3 Da    PI: 6.4158
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05937g02016.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.51.3e-2058666323100
                    DUF260  23 paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                a++ +++a v kl+ ++++++ll++lpe++r da+ss+vyeA+ar+rdPvyG+vg i+ lq+q++ l+  ++ +++e
  Niben101Scf05937g02016.1 586 RADELERLAKVFKLYNREELQELLQKLPEHQRGDAVSSMVYEANARVRDPVYGCVGAISYLQNQVSLLEMRVEIAQAE 663
                               56788999************************************************************9999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557813.68E-6102181IPR029016GAF domain-like
Gene3DG3DSA:3.30.450.404.3E-5106181IPR029016GAF domain-like
PROSITE profilePS5089111.723535664IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-19586661IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MAGGNEAFRI CSSVSEALSY MPFSLQYTEP NTKNDLWVFW SQHNSEFPTV FSSTAYTTIY  60
HDTIKEKITS ALKNAYISDN FGCWSECLKF RIPIVTDCSD NEYRLGPIGR VFKHGLPEMS  120
PDVSRYSAND YPQHGLVSAA GLGNYLAVPV FEPLNNQSIG VLEIIGDKKG SFSEDLVQMV  180
YEMLNKVDLR SSNMYGHPDE KDFKGLARAL KEIEEQLSFI CRTHQLPLAQ TWLPILDGSS  240
LKRFMTTKEQ FCICTSAGYE FRAACDMFHL GKSQGVVSKA FLTCSSCFCS DITQLSMTEY  300
PLAHVAHRVG LHSSFAICLQ SSYTGDYVYL LEFFFPQDNK SDCRSPQTIL NMLLASMKRQ  360
FRSFKLASGQ KLGEKLSVEI IPVPADDGLN SFEICHSVKP LSDIEAVARP GKIEWFDPLN  420
RLSKSGSTVN ICPKNIDLTT SSRTANTTTK VTNMRVLTSR VLSNSSKGEG MMTVSEGHHR  480
INSVVLQQSV GAKVNGTETT LASQSAPNSL GTKHLEINDM NCSSDQLESA KVADRHCEEC  540
SGGDQSCHET TTSLTHAAKP TTQAAGVQNE SIIPRKYPNF LLSGVRADEL ERLAKVFKLY  600
NREELQELLQ KLPEHQRGDA VSSMVYEANA RVRDPVYGCV GAISYLQNQV SLLEMRVEIA  660
QAEALCMQMD MADPKKLREP LWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-1958866535112LOB family transfactor Ramosa2.1
5ly0_B7e-1958866535112LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767935.10.0PREDICTED: protein NLP7-like isoform X1
RefseqXP_009767936.10.0PREDICTED: protein NLP7-like isoform X2
RefseqXP_009767937.10.0PREDICTED: protein NLP7-like isoform X3
RefseqXP_009767938.10.0PREDICTED: protein NLP7-like isoform X3
RefseqXP_009767939.10.0PREDICTED: protein NLP7-like isoform X3
RefseqXP_009767940.10.0PREDICTED: protein NLP7-like isoform X3
TrEMBLA0A1U7VIP60.0A0A1U7VIP6_NICSY; protein NLP7-like isoform X3
TrEMBLA0A1U7W1040.0A0A1U7W104_NICSY; protein NLP7-like isoform X1
STRINGXP_009767935.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1367533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.15e-52NIN like protein 7