PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05929g06012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 426aa    MW: 48470.1 Da    PI: 5.8718
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05929g06012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS224.26.5e-69554212373
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl... 83 
                                elL + A+ v+++++ +a+++L+  +  as +g+p+qR++ yf+ AL++r+ r+  ++  + +   ++ +n +eel  + l   
  Niben101Scf05929g06012.1  55 AELLQASAQLVATRKFDRATKFLSLCNLSASATGTPVQRIVYYFADALQHRIDREIGKVPITREEDIEAYSNDVEELV-MDLepa 138
                               5789999***********************************************555554443333333233333333.323346 PP

                      GRAS  84 .fse..vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetger 164
                                f +  ++P+ +++ +t  qaIl+ + ++++vH iD+ i+ G +W +++q+La+R+e p  +l+i +vg+    sk+++  +g+r
  Niben101Scf05929g06012.1 139 vFAKrpLFPYRQVTSFTGIQAILDCITTAKKVHLIDLCIKSGSHWTTFMQTLADRDECPLkHLKISAVGR----SKKKMDDVGRR 219
                               6654449*************************************************65544*********....9********** PP

                      GRAS 165 LakfA.eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                               L+ fA e+l+v+f+f++ v+++l +l+ e+++v+++E++aV   + l ++l  + ++es    ++k++ksl+P ++v++e  a++
  Niben101Scf05929g06012.1 220 LSAFAaERLNVSFSFKT-VVSDLRNLKSESFEVETDEVVAVYTDVILWTMLPWPNDMES----LMKVIKSLNPCIIVLIEGIANT 299
                               ****73679********.7999****************************977777777....********************** PP

                      GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                                 ++F + f e+l+y+sal d+ e      ++    +E +++++ i+n+++  g+e + rh +l+ Wr+ + ++G+ +  ls+  
  Niben101Scf05929g06012.1 300 YLPDFIDSFNETLSYFSALTDCSEFL----HKGVPIYEGFYIQKIIRNMITYHGEENVPRHGNLKVWRDLFAKFGMVETDLSHLS 380
                               **********************9998....89999************************************************** PP

                      GRAS 334 akqaklllrkvksdg.yrveeesgslvlgWkdrpLvsvSaW 373
                                 +a+ll  k  ++g  + + +++ lv+ Wk+ p++ vSaW
  Niben101Scf05929g06012.1 381 LIEASLLFDKSVFRGlCTCQLDEKFLVISWKRTPMICVSAW 421
                               ************999788999999999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.52628401IPR005202Transcription factor GRAS
PfamPF035142.2E-6655421IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MDSLELLSAP TIMKIARQRL LNHIAQKSDA YSIIFNPPTA NSGLSPELEQ DLDLAELLQA  60
SAQLVATRKF DRATKFLSLC NLSASATGTP VQRIVYYFAD ALQHRIDREI GKVPITREED  120
IEAYSNDVEE LVMDLEPAVF AKRPLFPYRQ VTSFTGIQAI LDCITTAKKV HLIDLCIKSG  180
SHWTTFMQTL ADRDECPLKH LKISAVGRSK KKMDDVGRRL SAFAAERLNV SFSFKTVVSD  240
LRNLKSESFE VETDEVVAVY TDVILWTMLP WPNDMESLMK VIKSLNPCII VLIEGIANTY  300
LPDFIDSFNE TLSYFSALTD CSEFLHKGVP IYEGFYIQKI IRNMITYHGE ENVPRHGNLK  360
VWRDLFAKFG MVETDLSHLS LIEASLLFDK SVFRGLCTCQ LDEKFLVISW KRTPMICVSA  420
WMFQQY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-307942126374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798274.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016450439.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM0ZMM40.0M0ZMM4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000039540.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-39RGA-like 1