PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05809g01004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 339aa    MW: 38599.9 Da    PI: 7.9709
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05809g01004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.71.1e-5381371129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgy 82 
                               +ppGfrFhPtdeel+++yLkkk++ +k+++ evi+evd++k+ePwdL++k+k     ++ewyfFs++d+ky+tg+r+nrat++g+
  Niben101Scf05809g01004.1   8 VPPGFRFHPTDEELLHYYLKKKISFQKFDM-EVIREVDLNKIEPWDLQEKCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGF 91 
                               69****************************.99**************964444222455************************** PP

                       NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Niben101Scf05809g01004.1  92 WKATGRDKCIRN-SFKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 137
                               ***********9.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-605159IPR003441NAC domain
PROSITE profilePS5100558.2528159IPR003441NAC domain
PfamPF023656.3E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MATSSGGVPP GFRFHPTDEE LLHYYLKKKI SFQKFDMEVI REVDLNKIEP WDLQEKCKIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNSFKKIGM RKTLVFYRGR  120
APHGQKTDWI MHEYRLEDAD DPQGNQSDDG WVICRVFKKK HLFKVGNEGG GATSSDQLNS  180
TSSHQSRAFN SQYLLQQQGG HGLNYSHIPL ALPQYNSHLQ LQPQNFIPNK PLGYHDFSAI  240
PTSDYQAPLM VKQLMSNADS SCSDQNLAYQ QEVGSRCDHQ NLNEWGMIAS SHSQLGHGQE  300
DDDSAKNAGV RFDDANASSM SQINQLSLRG EMDFWGYTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-53816017166NO APICAL MERISTEM PROTEIN
1ut4_B2e-53816017166NO APICAL MERISTEM PROTEIN
1ut7_A2e-53816017166NO APICAL MERISTEM PROTEIN
1ut7_B2e-53816017166NO APICAL MERISTEM PROTEIN
3swm_A3e-53816020169NAC domain-containing protein 19
3swm_B3e-53816020169NAC domain-containing protein 19
3swm_C3e-53816020169NAC domain-containing protein 19
3swm_D3e-53816020169NAC domain-containing protein 19
3swp_A3e-53816020169NAC domain-containing protein 19
3swp_B3e-53816020169NAC domain-containing protein 19
3swp_C3e-53816020169NAC domain-containing protein 19
3swp_D3e-53816020169NAC domain-containing protein 19
4dul_A2e-53816017166NAC domain-containing protein 19
4dul_B2e-53816017166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019236848.10.0PREDICTED: protein BEARSKIN2-like
SwissprotQ9SV871e-130BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A1J6JYI60.0A0A1J6JYI6_NICAT; Protein bearskin2
STRINGXP_009602081.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-130NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]