PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05694g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 334aa    MW: 36939.8 Da    PI: 10.0341
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05694g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA88.21.1e-27166220258
                 CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                p++VNaKQy++Il+RR++Rak  e kk   k rkpylh SRh hA+rRpRg+gGrF
  Niben101Scf05694g00003.1 166 GPIFVNAKQYHGILRRRKSRAKEME-KKA-LKPRKPYLHLSRHLHAMRRPRGCGGRF 220
                               69*******************9666.555.6*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-30163223IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.964164223IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-23167220IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.9E-21167189IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.9E-21197220IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MELPLDFQEK RRELLLRFAF MSIMHTLFSK GNEGIAENPI ATLSTTVPWW NSGLVSQSDP  60
FGQLKSASVE HTELPKGNAT EFTIFSVSPS GDWKSSGYGQ NQSNIQAAAT SVNMDYRSHF  120
ELGFSQSLIS AKYPYGGQQS VGLFSAYGPQ ISGRVMLPLN LASDEGPIFV NAKQYHGILR  180
RRKSRAKEME KKALKPRKPY LHLSRHLHAM RRPRGCGGRF LNTRKMNGTM KGGKTNDTVK  240
TGDVHSFYPT GSQNSEVLQS DSSNLSSPKE TTGSRFCHSS EVTNMYSRGN LDPFLFQDLR  300
PSVQAIPDTM NTGHGILMAG KWVSAADSCC NLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A5e-16165221260HAPB protein
4g92_A5e-16165221260HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019249296.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLA0A1J6J6P30.0A0A1J6J6P3_NICAT; Nuclear transcription factor y subunit a-2
STRINGXP_009761897.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.23e-45nuclear factor Y, subunit A10