PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05506g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 246aa    MW: 28047.4 Da    PI: 8.1297
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05506g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.2e-201978357
                              --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                              +R+++tkeq++ Le+ +++  r+psae++++++ +l    +++ ++V++WFqN++a++++
  Niben101Scf05506g06001.1 19 SRWNPTKEQIDLLESIYRQgIRTPSAEQIQQITLRLrafgHIEGKNVFYWFQNHKARQRQ 78
                              6*****************99**************************************97 PP

2Wus_type_Homeobox114.36e-371880365
         Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                               +RW+Pt+eQi +Le++y++G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
  Niben101Scf05506g06001.1 18 GSRWNPTKEQIDLLESIYRQGIRTPSAEQIQQITLRLRAFGHIEGKNVFYWFQNHKARQRQKQ 80
                              58***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6571479IPR001356Homeobox domain
SuperFamilySSF466892.82E-121683IPR009057Homeodomain-like
SMARTSM003891.9E-41683IPR001356Homeobox domain
PfamPF000461.2E-171978IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-81978IPR009057Homeodomain-like
CDDcd000861.27E-62080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MNDDNNSVEM LVSETPVGSR WNPTKEQIDL LESIYRQGIR TPSAEQIQQI TLRLRAFGHI  60
EGKNVFYWFQ NHKARQRQKQ KQDKFAYFNR FLHRTNVFPP SRPNVVCSPY YTPQNNLGFY  120
QQYPVPSLIL PAPGGFKRRA TCDAAVFINA TYSQENSTNM AHLCPSEKQF NHQETLNLFP  180
LHPTGILQEK TTSSSSPYAH DQSSIPSNYT TSNFVEANCL IDLGIGASDH QVFNFLCGKG  240
PCESQY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758504.11e-176PREDICTED: WUSCHEL-related homeobox 2
RefseqXP_016513970.11e-176PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLA0A1S4DKP71e-174A0A1S4DKP7_TOBAC; WUSCHEL-related homeobox 2-like
TrEMBLA0A1U7V8C91e-174A0A1U7V8C9_NICSY; WUSCHEL-related homeobox 2
STRINGXP_009758504.11e-175(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.16e-39WUSCHEL related homeobox 2