PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05391g01009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 527aa    MW: 59073.1 Da    PI: 6.5102
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05391g01009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ409.85.3e-1262484671217
                       VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipeceg 82 
                               pp saflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg pg  pv+rp gi+lkd+llf+al ak++gk+vg+p+ceg
  Niben101Scf05391g01009.1 248 PPASAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALGAKAHGKDVGVPQCEG 332
                               789**********************944459****************************************************** PP

                       VOZ  83 aatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfew 167
                               aatakspwna+elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ew
  Niben101Scf05391g01009.1 333 AATAKSPWNAPELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEW 417
                               ************************************************************************************* PP

                       VOZ 168 hlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                               hlyeyein++da+alyrlelklvd+kk +kgkv++ s++dlqk++grlta
  Niben101Scf05391g01009.1 418 HLYEYEINKYDAYALYRLELKLVDGKKISKGKVTNVSVSDLQKQMGRLTA 467
                               ************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MRLPRIHELS SDCCFLFFRC GVEGIVLFDW MRKVSKRGAC KSASHQLFKD RAKNRVDDLQ  60
GVLTNLQSAR KESRSYDVGL LEEQVHQMLR EWKAELNEPS PASSLQARTT LTPFYVGVLH  120
SWVTLQGGSL VSSSDIYRLL LGEEEDDATS ALAAPKPEPD AQKVSVTGFH GGFNATQMLQ  180
EQGFQLVDQC KGLPLVVSNV GINNLGIATQ LDYHSFDLHQ EYDQQYLPGF DALNLCLEDA  240
LPPIHISPPA SAFLGPKCAL WDCPRPAMGS DWCQKSQDYC SDYHASLAPN EGYPGRPPVV  300
RPMGIGLKDN LLFQALGAKA HGKDVGVPQC EGAATAKSPW NAPELFDLKV VEGETIREWL  360
FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQMMNEFGG LKRSYYMDPQ PMKNLEWHLY  420
EYEINKYDAY ALYRLELKLV DGKKISKGKV TNVSVSDLQK QMGRLTAEFP LDNKRTVKGR  480
AKAANLKNVG NIQAAPIPLV PTCEGFDYGT GEPYDYLVDD LDGYFIT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018625367.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_018625368.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_018625369.10.0PREDICTED: transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1J6K8180.0A0A1J6K818_NICAT; Transcription factor voz1
STRINGXP_009780205.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]