PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05374g04014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 391aa    MW: 44853.5 Da    PI: 5.1217
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05374g04014.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix73.73.2e-23281364186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW+k+ev++L+ +r  +++++ +g +k+  Weev++ ++++g+ r+pk+Ckekwen+nk+yk++ ++ k    +s ++cpyf++l
  Niben101Scf05374g04014.1 281 RWPKSEVQDLVSIRIALDHKFLKG-AKGSVWEEVADGLAKKGYIRTPKKCKEKWENINKYYKRTIDSGKAC-LRSYRSCPYFREL 363
                               8**********************9.99****************************************9986.556679*****99 PP

                  trihelix  86 e 86 
                               +
  Niben101Scf05374g04014.1 364 D 364
                               7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.073274337IPR017877Myb-like domain
CDDcd122032.29E-19280343No hitNo description
PfamPF138374.5E-18280364No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MELLTDGDGH RSNDVTTFPD NNLTPFPVST NAVYFNPASV VPPPPEIDHL PVSPARKLRP  60
VRCGNGRSYV DMVDSSCDLD ETLMNCSCDL GGFFSQFSAQ NANAVIPTEC GFEFSEVQQM  120
KSVFDADCFN LISQARILQA EFSSSSDDSE SAEAIEERLN RKRKRETRKS LKLYLEDMAS  180
RLMDKQEQMY KQLIEMIERK EQERIIREEA WKQQEIERTK RDEEVRAEET SRNMALISFL  240
ENMLGDEFPI PKSSEMSSRV KDEGEVHGQE ADVRSDPCNR RWPKSEVQDL VSIRIALDHK  300
FLKGAKGSVW EEVADGLAKK GYIRTPKKCK EKWENINKYY KRTIDSGKAC LRSYRSCPYF  360
RELDILYKSH LLTQGTGDCV KSETESKKVE E
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771160.10.0PREDICTED: trihelix transcription factor GT-2
TrEMBLA0A1U7WAA50.0A0A1U7WAA5_NICSY; trihelix transcription factor GT-2
STRINGXP_009771160.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128841620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.14e-41Trihelix family protein