PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05372g05016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 198aa    MW: 22023 Da    PI: 7.0133
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05372g05016.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.92.6e-41361351100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe er da+ss+vyeA+ar+rdPvyG++g i +lq+
  Niben101Scf05372g05016.1  36 PCAACKILRRRCAEKCVLAPYFPPNNPIKFTTAHRVFGASNIIKFLQELPECERADAVSSMVYEANARLRDPVYGSAGAICQLQK 120
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+++l+a+la+ ++e
  Niben101Scf05372g05016.1 121 QVNELQAQLAKSQAE 135
                               **********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5135136IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-4136133IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MESSNRTVPT TTTPLSPYSV SPSRNSPSPP RVVITPCAAC KILRRRCAEK CVLAPYFPPN  60
NPIKFTTAHR VFGASNIIKF LQELPECERA DAVSSMVYEA NARLRDPVYG SAGAICQLQK  120
QVNELQAQLA KSQAEIVNMQ CQQTNLMALL YMEMDQSPPA SPQQSLDNFT SNTFQNSISF  180
LDDQNTNFGS LWDQPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-403514510120LOB family transfactor Ramosa2.1
5ly0_B3e-403514510120LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626018.11e-115PREDICTED: LOB domain-containing protein 1-like
RefseqXP_019227600.11e-115PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A314KQ101e-114A0A314KQ10_NICAT; Lob domain-containing protein 1
STRINGXP_009626018.11e-114(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-75LOB domain-containing protein 1