PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05357g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 125aa    MW: 14222.5 Da    PI: 9.3071
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05357g00010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-4211109199
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+l+r+C+++C +apyf +++pkkfanvhk+FGasnv+k+l+++pe++red+++slvyeAe+r+rdPvyG++g i +lq+
  Niben101Scf05357g00010.1  11 SCAACKFLKRRCTQNCQFAPYFRSDEPKKFANVHKVFGASNVSKILNEVPEDQREDTVNSLVYEAEVRLRDPVYGCIGAIASLQR 95 
                               6************************************************************************************ PP

                    DUF260  86 qleqlkaelallke 99 
                               ++ +l+++l l+++
  Niben101Scf05357g00010.1  96 KMVELQHDLMLART 109
                               ********999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6810111IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4111108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MKSNEPRSSS SCAACKFLKR RCTQNCQFAP YFRSDEPKKF ANVHKVFGAS NVSKILNEVP  60
EDQREDTVNS LVYEAEVRLR DPVYGCIGAI ASLQRKMVEL QHDLMLARTR LAYLLQSKTL  120
LLIVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4761116111LOB family transfactor Ramosa2.1
5ly0_B3e-4761116111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016497209.14e-78PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL88e-61LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A1S4C8C58e-77A0A1S4C8C5_TOBAC; LOB domain-containing protein 21-like
STRINGXP_009786680.11e-77(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.13e-63LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]