PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05272g03013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 336aa    MW: 37996.9 Da    PI: 5.9762
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05272g03013.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.35.9e-39591581100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCaaCk++rrkCa+dCvlapyfp++++++f n+hklFG+sn++k++++l++  +++am+++++++++ra+dPv G++++i++lq+
  Niben101Scf05272g03013.1  59 ACAACKYQRRKCAPDCVLAPYFPHDRQRQFLNAHKLFGVSNITKIIRHLDQPLKDEAMRTIIFQSDVRANDPVGGCYRIIRDLQR 143
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               +++  kael+ + ++
  Niben101Scf05272g03013.1 144 HIDYCKAELDIVLHQ 158
                               *********988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.19858159IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3659154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MQNQMTTIST PITNHPHTTH TFTTSNNLNH NCSTKRINNN NNNNNNKNVL LRVNGAGQAC  60
AACKYQRRKC APDCVLAPYF PHDRQRQFLN AHKLFGVSNI TKIIRHLDQP LKDEAMRTII  120
FQSDVRANDP VGGCYRIIRD LQRHIDYCKA ELDIVLHQLA YCRAQAVATA ASEQQILADH  180
HATEESFNEN NCDAVVNQAD PLVNNNASSY DQQTIDYHSH SYYNHTSCQQ GEDDQQYDEI  240
QDGQLDLADI NFPWSLHEQE STSTSAPNSL MKQLSVHDQY DNIKPILEGI SGFGEEGLSF  300
EHDQAFDQHS IEHKTLNSSA NCKAELFWGM IPSLAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-27551537105LOB family transfactor Ramosa2.1
5ly0_B6e-27551537105LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019228565.10.0PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A1S3XPA60.0A0A1S3XPA6_TOBAC; LOB domain-containing protein 22-like
STRINGXP_009623735.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.19e-55LOB domain-containing protein 22