PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05249g04004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 306aa    MW: 34444.7 Da    PI: 7.1926
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05249g04004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.68.8e-4371061100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lq+
  Niben101Scf05249g04004.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEYRLRDPVYGCVGLISLLQH 91 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               +l+q++ +l  +k+e
  Niben101Scf05249g04004.1  92 KLRQVQDDLLNAKKE 106
                               ********9888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6636107IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSSSHSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISLLQ HKLRQVQDDL LNAKKELATY IGPSAMLPIL  120
QPQGFLQPHH MNNHSSSTVM PFNVNPMLGM PTGVPHGGQL MICDPQQQQT IEAQQLAAAM  180
AAREQQEMLR NYEQQQQHPQ QQDIVRFNSG FDSTGSVTAT GFHQMNSSPI SASLALGSYE  240
NNPYNLVQQQ QPQQQEQNHP HHQQIHIQPQ LLLQQQQHQT PQQPETPRQQ QRAKSEEERR  300
SVGPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4831107114LOB family transfactor Ramosa2.1
5ly0_B6e-4831107114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792980.11e-168PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016501970.11e-168PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A1S4CLH71e-167A0A1S4CLH7_TOBAC; LOB domain-containing protein 36-like
TrEMBLA0A1U7Y2I11e-167A0A1U7Y2I1_NICSY; LOB domain-containing protein 36-like
STRINGXP_009792980.11e-168(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-79ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]