PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05188g03027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 261aa    MW: 27652.2 Da    PI: 10.1547
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05188g03027.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP119.63.7e-37351313100
                       TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                               +kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++ s++ ++s s+ +s+ss+
  Niben101Scf05188g03027.1  35 VKKPPVKDRHSKVDGRGRRIRMPIVCAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTIPTSFS-TVSVSVRSSSSSI 118
                               69999***************************************************************777.3444444443455 PP

                       TCP  88 gkaaksaakskks 100
                                 ++ sa+  +k+
  Niben101Scf05188g03027.1 119 LTSCISAPLDHKQ 131
                               4555555433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.6134094IPR017887Transcription factor TCP subgroup
PfamPF036346.0E-3441129IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSTSAEGNGA IIDPHQRQQQ QNPSGGGGTN GALIVKKPPV KDRHSKVDGR GRRIRMPIVC  60
AARVFQLTRE LGHKSDGQTI EWLLRQAEPS IIAATGTGTI PTSFSTVSVS VRSSSSSILT  120
SCISAPLDHK QPPSSQPLIS PAPFILGKRL RPDDETIENG HKEDVGRAAT VVGPTSGFCA  180
VPARPDFGQV WSFAAAPPEM MVPTSAALSL QSSRFFQQQM GEASAARVGN YLPMTQGHLN  240
LLASLSGPPQ PSSGRRDDDG R
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444705.11e-166PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX21e-87TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A1S3XXV31e-164A0A1S3XXV3_TOBAC; transcription factor TCP7-like
STRINGXP_009588219.11e-163(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39512242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.17e-69TCP family protein