PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05060g08015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 308aa    MW: 35465.8 Da    PI: 6.2438
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05060g08015.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.36e-57161411128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL++kv + ++++ ++i evd++kvePwdLp k+k +ekewyfF+ rdkky+tg+r+nrat++gyWka
  Niben101Scf05060g08015.1  16 LPPGFRFHPTDEELITHYLAPKVLDCNFSA-KAIGEVDLNKVEPWDLPWKAKMGEKEWYFFCIRDKKYPTGQRTNRATEAGYWKA 99 
                               79**************************99.88***************888999******************************* PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               tgkdke+++ +++lvg+kktLvfykgrap+gekt+Wvmheyrl
  Niben101Scf05060g08015.1 100 TGKDKEIFR-SKTLVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 141
                               *********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-6112151IPR003441NAC domain
PROSITE profilePS5100554.95716164IPR003441NAC domain
PfamPF023651.0E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
METACGFEGY EEEMELPPGF RFHPTDEELI THYLAPKVLD CNFSAKAIGE VDLNKVEPWD  60
LPWKAKMGEK EWYFFCIRDK KYPTGQRTNR ATEAGYWKAT GKDKEIFRSK TLVGMKKTLV  120
FYKGRAPRGE KTNWVMHEYR LDGKYSVHNL PKSAQIAITS LIRNNNMTES PRSSNLPPLM  180
DMSPYNNQIT TTTRSSGETS NSHVTCFSDS MEDQKPQTHQ PLACSPPSVD FPKYPSNTPK  240
QVMQPYIENF QYVDSGLMQD NSILRLLLEN NSYESESKHN NHLRGYEDHN DFNINSAGPV  300
DLDCLWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-511314114142NO APICAL MERISTEM PROTEIN
1ut4_B4e-511314114142NO APICAL MERISTEM PROTEIN
1ut7_A4e-511314114142NO APICAL MERISTEM PROTEIN
1ut7_B4e-511314114142NO APICAL MERISTEM PROTEIN
4dul_A4e-511314114142NAC domain-containing protein 19
4dul_B4e-511314114142NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768516.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-106NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1U7VUA00.0A0A1U7VUA0_NICSY; NAC domain-containing protein 100-like
STRINGXP_009768516.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-108NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]