PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05030g04002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 340aa    MW: 39610.3 Da    PI: 7.1495
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05030g04002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.3e-5671311129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               +ppGfrFhPtdeelv++yL+kk+++++++l +vik+vd+yk+ePwdL+   ++e++ewyfFs++dkky+tg+r+nrat++g+Wka
  Niben101Scf05030g04002.1   7 VPPGFRFHPTDEELVDYYLRKKITSRRIDL-DVIKDVDLYKIEPWDLQ--GTEEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKA 88 
                               69****************************.9***************8..345789***************************** PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               tg+dk+++s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Niben101Scf05030g04002.1  89 TGRDKAIYS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 131
                               *********.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-615150IPR003441NAC domain
PROSITE profilePS5100559.4777150IPR003441NAC domain
PfamPF023657.2E-298130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKIT SRRIDLDVIK DVDLYKIEPW DLQGTEEQNE  60
WYFFSHKDKK YPTGTRTNRA TAAGFWKATG RDKAIYSKHD LIGMRKTLVF YKGRAPNGQK  120
SDWIMHEYRL ETDPNGAPQA RWVVCRVFKK RIATMRKESE RESPIWYDHD QVSFMPEMDS  180
PKQQYSQSSL TYQYPNYPCK KEQDNLHYQI PRPHYHQQFL QLPLLESPKL LPPPPCSSMP  240
VFAINVNNQV HQCGNHNNIS SNTNELVGDD HQVMDWRVLD KFVASQLSQE EVSKENDYSN  300
TLQGAADDSN LNIVRNLNKQ EAAAENTSTA SSSSQIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-47615114169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019258894.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-125NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A314LF710.0A0A314LF71_NICAT; Nac domain-containing protein 7
STRINGXP_009599621.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-101NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]