PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04921g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 310aa    MW: 34125.5 Da    PI: 10.2302
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04921g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA83.72.9e-26142196258
                 CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                p++VNaKQy++Il+RR++ ak  e kk   k rkpylh SRh hA+rRpRg+gGrF
  Niben101Scf04921g00005.1 142 GPIFVNAKQYHGILRRRKSWAKEME-KKG-LKPRKPYLHLSRHLHAMRRPRGCGGRF 196
                               69*******************9766.554.5*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-28139199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115230.364140199IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.3E-22143196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-19143165IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-19173196IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MTIMHTLFSK GSEAIAQNTV VTLSNTVPWW NSGLVSQSYP FGQLKSASLE HSELPKGNAT  60
EFTIFSGDWK SSGYGQNQSN IQAAATSANM DFRGHFELGF GQSLISAKYP YGGEQSVGLF  120
SAYGPQLSGR IMLPLNLASD EGPIFVNAKQ YHGILRRRKS WAKEMEKKGL KPRKPYLHLS  180
RHLHAMRRPR GCGGRFLNTR KMNGTMKGGN TNDTLKTGDV HSFYPSGSQN SEVRQSDSSN  240
LSSSKETTGS RFRHSSEVTN IYSRGNLDPF LFQDLRPSVQ AIPDMMNTGH GILMAGKWVS  300
AADSCCNLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A2e-15141197260HAPB protein
4g92_A2e-15141197260HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019249303.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X3
TrEMBLA0A1J6J6P30.0A0A1J6J6P3_NICAT; Nuclear transcription factor y subunit a-2
STRINGXP_009761897.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.19e-43nuclear factor Y, subunit A2