PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04905g07006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 392aa    MW: 44393.7 Da    PI: 6.1062
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04905g07006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.71.7e-2452122272
                  trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt 72 
                               W ++e++aLi +rre+++ ++++k++k+lW+++s kmre+gf rsp++C++kw+nl k++kk k++++ + 
  Niben101Scf04905g07006.1  52 WVQEETRALISLRRELDSLFNTSKSNKHLWDQISLKMREKGFDRSPTMCTDKWRNLLKEFKKAKHNQELNG 122
                               ****************************************************************9988763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-443110IPR009057Homeodomain-like
PROSITE profilePS500908.71144108IPR017877Myb-like domain
SMARTSM007176.8E-648110IPR001005SANT/Myb domain
CDDcd122031.92E-2850115No hitNo description
PfamPF138376.9E-1851123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MIIEVATPDA HLQQPQQILL PGISGGDTTS SGGEDNNNNN LKLAPKKRAE TWVQEETRAL  60
ISLRRELDSL FNTSKSNKHL WDQISLKMRE KGFDRSPTMC TDKWRNLLKE FKKAKHNQEL  120
NGSAKMSEAE TIPFTWMKVS LQKKTILYLK KVLLMASSEE GDEYENGRPT LNLERQLDHD  180
GHPLAITAAD AVTASGSPWN WRETPGNENG RPTLNLERQL DHDGHPLAIT AADAVTASGS  240
PWNWRETPGN GEQSNSAGGR VISVKWGDYT KRIGIDGTAD AIKQAIKSAF RLRTERAFWL  300
EDEQNIVRAL DRDMPLESYT LHVDEGLTIK VCMYEEADHL PVHTEDKTFY TTNDFRDFLS  360
HRGWTCLREY NGYRHVDMLD ELCPGAVYRG VN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A1e-4146127182DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00640PBMTransfer from MDP0000164819Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016434047.10.0PREDICTED: trihelix transcription factor GT-4-like
SwissprotQ9LU921e-137TGT4_ARATH; Trihelix transcription factor GT-4
TrEMBLA0A1S3X2C20.0A0A1S3X2C2_TOBAC; trihelix transcription factor GT-4-like
STRINGXP_009784713.10.0(Nicotiana sylvestris)
STRINGXP_009599397.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51132136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25990.11e-135Trihelix family protein