PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04869g07001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 251aa    MW: 27812 Da    PI: 9.4934
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04869g07001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.12.2e-31175231158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep++VNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
  Niben101Scf04869g07001.1 175 QEPVFVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 231
                               69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34173234IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.027174234IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-26176231IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-22177199IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860179199IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.0E-22208231IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MQSKSKSAIC GEARIFNAPN SIVYSEPWWN TAGYNPVSMG LMRGSASDSS SREQSVDGRS  60
QSDGGASEED DDAPEKSQSN IPMHSDGSYR QQQQQQQTQF DQNLQPIAST IPPKGDGSQT  120
QPPQLELVTH SIACAPNLYA DLYYGGMMTP FGQRMVPHVI DMHHPRMPLP HEMAQEPVFV  180
NAKQYHGILR RRESRAKAEL EKKLIKVRKP YLHESRHQHA LKRARASGGR FAKKSDTDTS  240
KGTGSGSGSK F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-18175247274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617196.11e-156PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_009617197.11e-156PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_018630899.11e-156PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLA0A1S3XRI41e-154A0A1S3XRI4_TOBAC; nuclear transcription factor Y subunit A-1-like
STRINGXP_009617196.11e-155(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-48nuclear factor Y, subunit A1