PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04819g03003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 831aa    MW: 94079.2 Da    PI: 5.5356
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04819g03003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS257.45.1e-7954882988374
                      GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakfAee 171
                                P+ ++ +++  qaI e v+g++++H +Df+i  G+Q   L+qaLa +R+++   l+iT++g+   ++ke++eetg+rL++fA++
  Niben101Scf04819g03003.1 548 IPFSQVMQFAGVQAIIENVKGATKIHLVDFNIRTGIQCTGLMQALAeERDRPIELLKITAIGH---QEKEKIEETGKRLQSFANS 629
                               69********************************************88889999*********...579**************** PP

                      GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                               l++pf+fn++ +++++dl+ e+ +vk +E++aV + + l ++     + +++ d++++++++l+P vv+v+e ea+hns+sFl+r
  Niben101Scf04819g03003.1 630 LNLPFSFNIVFMSDMKDLRAESVNVKADETVAVYCNIVLRTMI----CRPEYMDNTMRVIRGLRPSVVIVCEVEANHNSPSFLNR 710
                               ******************************************9....55666667****************************** PP

                      GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                               f+eal +ys+lfd++e  + re+  r+ +E + +g+ i+n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l+l
  Niben101Scf04819g03003.1 711 FVEALFFYSVLFDCFEDCMDRENLVRKRIEVFHIGEGIRNMVAAEGAERFTRNMKLDVWRAYFARFGMVEMELSESSWYQANLIL 795
                               ************************************************************************************* PP

                      GRAS 342 rkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               ++++ +   +v+++ ++l+ gWk+ p+ svS W+
  Niben101Scf04819g03003.1 796 KQFSqGSSCNVQNDGKALLVGWKGTPIESVSIWK 829
                               ****88889************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.938421808IPR005202Transcription factor GRAS
PfamPF035141.8E-76548829IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MGSSSQICHQ EEKKTISFFD YVANMLKESF QCLTIILLSL LLPLSFIVLA RLSVARYFIT  60
ISAEYYTLRD SLLVKIFLYA NPNILHVLVP LVAVSSLIHG LTGRTILFIK QSADHVTFKP  120
CLYTAWFFLF MLQICVCIGI EGSIAIGIGG SSSFSHHERL CLLSRVIFFF GLHETTSFWA  180
KKVVKPVVDD TVFGVATADD RVVEKVAMAM SFGVLWWWKL RDEVESLVVV AEVKRELIGS  240
VDLVDFVGWW LYYLTLAIGM VKIVKGLIWV CFVLFCGNVV DLENADYSTR NDEKGGHNQL  300
QECGRNELVD NGVVDPWFGL DSEDLDSLYS VLDLKYQENT SDKHVQLSED QQQNISDYCT  360
QSDDSSSNMD FPLQPVQIQS TFEASNRIQP QVPRPGNFHG EKTNPISSAS LELLNNCGRL  420
FKKSSEENLS NIHINEAHVS NISKLSTEEI LRVAGERYIQ YSTQRVDGLS MFMHPYASAL  480
SGLSIEQTRD MELVHLLLAA AEEVDQQQFH LASQSVARRS PSFERKLRYL STLALGTTPE  540
ALTCHTEIPF SQVMQFAGVQ AIIENVKGAT KIHLVDFNIR TGIQCTGLMQ ALAEERDRPI  600
ELLKITAIGH QEKEKIEETG KRLQSFANSL NLPFSFNIVF MSDMKDLRAE SVNVKADETV  660
AVYCNIVLRT MICRPEYMDN TMRVIRGLRP SVVIVCEVEA NHNSPSFLNR FVEALFFYSV  720
LFDCFEDCMD RENLVRKRIE VFHIGEGIRN MVAAEGAERF TRNMKLDVWR AYFARFGMVE  780
MELSESSWYQ ANLILKQFSQ GSSCNVQNDG KALLVGWKGT PIESVSIWKF L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3254382982375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477658.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK4C3Z10.0K4C3Z1_SOLLC; Uncharacterized protein
STRINGSolyc06g009610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.19e-45RGA-like 1