PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04654g03022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 236aa    MW: 27817.7 Da    PI: 8.0562
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04654g03022.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM70.35e-22131413128
                       NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykv.ePwdLp.kkvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                               +G+rFhPt+ el+ ++Lk+ ++g+ l+ e + ++ +diy    Pw++  ++ ++ eek  y F++ +kk+++ +r +r+ + g+W
  Niben101Scf04654g03022.1  13 MGVRFHPTEAELI-NFLKRFLKGELLQSECHnFQLADIYGDqPPWEIFeANSDHpEEKVRYIFTRLKKKKKEHSRVRRTCAYGTW 96 
                               7************.9********9977755559999***87368***6233333244566************************* PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               k +    ++++ kg++vg ++ + f + +++  ++  W+m ey++
  Niben101Scf04654g03022.1  97 KGQTGIDPIKKGKGTVVGFRRCFKFQSRSKEGEHNKIWLMREYSV 141
                               *8888899**99*************977777777888******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-263163IPR003441NAC domain
PROSITE profilePS5100525.03411164IPR003441NAC domain
PfamPF023654.4E-1413141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MSMVPAARRG CIMGVRFHPT EAELINFLKR FLKGELLQSE CHNFQLADIY GDQPPWEIFE  60
ANSDHPEEKV RYIFTRLKKK KKEHSRVRRT CAYGTWKGQT GIDPIKKGKG TVVGFRRCFK  120
FQSRSKEGEH NKIWLMREYS VGDDFFRENN IPKEDIVVCR IKKNIRSMKN HWVNMEEQDV  180
PKVIDAMLRG PDEDYCTTVQ PETICQAADQ RQVNDWSNYQ QEFNWADDML IGIDDF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016461013.11e-155PREDICTED: NAC domain-containing protein 53-like
TrEMBLB3VK721e-157B3VK72_TOBAC; NAC transcription factor
STRINGXP_009793650.11e-153(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-14NAC domain containing protein 2