PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04437g04001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 212aa    MW: 23201.3 Da    PI: 6.2299
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04437g04001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.4e-43451441100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+
  Niben101Scf04437g04001.1  45 PCAACKILRRRCAEKCVLAPYFPPNDPVKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARLRDPVYGCAGAICQLQK 129
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+++l+a+la++++e
  Niben101Scf04437g04001.1 130 QVNELQAQLATAQAE 144
                               **********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.24744145IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-4345142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MEYSSDTKAT VISTSPPSSR SVSPPSSSSC SPNSPPPPPM VVVSPCAACK ILRRRCAEKC  60
VLAPYFPPND PVKFTTAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAN ARLRDPVYGC  120
AGAICQLQKQ VNELQAQLAT AQAEVVNMQC QQANLMALIC MDMNQSSPQA SPQQHSNLES  180
FTINIPHSFQ NNMSFLDDNN NFGSVWEPLM WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-434415210118LOB family transfactor Ramosa2.1
5ly0_B4e-434415210118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763968.11e-123PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016480560.11e-123PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4AVF61e-121A0A1S4AVF6_TOBAC; LOB domain-containing protein 1-like
TrEMBLA0A1U7VC881e-121A0A1U7VC88_NICSY; LOB domain-containing protein 1-like
STRINGXP_009763968.11e-122(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-63LOB domain-containing protein 1