PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04430g03018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 192aa    MW: 22357.8 Da    PI: 5.6448
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04430g03018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.18e-1385144564
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
                    bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                               +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN+ L ++l++ ++  +k+ +e++
  Niben101Scf04430g03018.1  85 RKQRRMVSNRESARRSRMRKQRHLDELWSQVLRLRTENQNLMNKLNQVTESHDKVIQENM 144
                               79***********************************************99999888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-1581145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.34683146IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.67E-1285135No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-1185135No hitNo description
PfamPF001708.2E-1185143IPR004827Basic-leucine zipper domain
CDDcd147021.04E-1886137No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MISSEAATIP YLAQENNPSS LPIDFCFIHK NLPAFQYNTF LTNNNIQNYQ ASFPVQDFSQ  60
QPSCISSNST SDESEEQQIR IIDERKQRRM VSNRESARRS RMRKQRHLDE LWSQVLRLRT  120
ENQNLMNKLN QVTESHDKVI QENMQLKEEA SDLRRMITDI QIDCPFHAFS DLDEVTCNTA  180
HLKAESSNQS TT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019224146.11e-131PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC21e-38BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A1J6IND31e-129A0A1J6IND3_NICAT; Basic leucine zipper 43
STRINGXP_009794536.11e-129(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.14e-48basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]