PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04407g02024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 329aa    MW: 37525.5 Da    PI: 4.846
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04407g02024.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-1993146356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k++++t++q++ Le+ F +++++  e++ +LAk+lgL+ rq+ +WFqNrRa++k
  Niben101Scf04407g02024.1  93 KKRRLTENQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWK 146
                               56689************************************************9 PP

2HD-ZIP_I/II127.46.2e-4192183192
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               ekkrrl+++qv++LE+sF ee+kLeperKv+la+eLglqprq+a+WFqnrRAR+ktkqlEk++e L+++yd+lk++ ++L ke+e
  Niben101Scf04407g02024.1  92 EKKRRLTENQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEKEFEELRNQYDNLKSDYNNLLKEKE 176
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreelk 92 
                               +Lr+e+ 
  Niben101Scf04407g02024.1 177 NLRAEVF 183
                               ***9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-1982150IPR009057Homeodomain-like
PROSITE profilePS5007117.70288148IPR001356Homeobox domain
SMARTSM003892.0E-1891152IPR001356Homeobox domain
CDDcd000864.52E-1793149No hitNo description
PfamPF000462.0E-1693146IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-1998147IPR009057Homeodomain-like
PRINTSPR000316.5E-6119128IPR000047Helix-turn-helix motif
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PRINTSPR000316.5E-6128144IPR000047Helix-turn-helix motif
PfamPF021833.0E-13148189IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MMAPGMLYSG GSGAFNFDGV LIQKERVMSS SSSTANEHLG SLFVPGCSSS YLGSSSMVSF  60
GRVNGGKRSF FDSFDQDENE ADELGEYYHQ AEKKRRLTEN QVQFLEKSFG EENKLEPERK  120
VQLAKELGLQ PRQIAIWFQN RRARWKTKQL EKEFEELRNQ YDNLKSDYNN LLKEKENLRA  180
EVFQLTDKLL LKERKNGQLT LRDFQKHSDA SPKETMADPI SRVKMSNVST RVLTLQQQED  240
LSSGKSDVLD SESPHYTDSS FIEQGDSSYV FEHEPSVLSQ EDEEKFNKTI LSTANLLAKA  300
EGDDYRVTSS NVSYFGFPGE DQGFGFWSY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019250667.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLM1CDJ81e-176M1CDJ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000652071e-176(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-42homeobox 1