PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04133g02029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 309aa    MW: 35332.7 Da    PI: 7.5198
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04133g02029.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.49.2e-43161271128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL++kv + ++++ ++i ++              k +ekewyfF+ rdkky+tg+r+nrat++gyWka
  Niben101Scf04133g02029.1  16 LPPGFRFHPTDEELITHYLAPKVLDCNFSA-KAIGKA--------------KMGEKEWYFFCIRDKKYPTGQRTNRATEAGYWKA 85 
                               79***********************99999.555552..............34789***************************** PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               tgkdke+++ +++lvg+kktLvfykgrap+gekt+Wvmheyrl
  Niben101Scf04133g02029.1  86 TGKDKEIFR-SKTLVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 127
                               *********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-5412152IPR003441NAC domain
PROSITE profilePS5100539.6916152IPR003441NAC domain
PfamPF023651.7E-2917127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
METVCGFEGH EEEMELPPGF RFHPTDEELI THYLAPKVLD CNFSAKAIGK AKMGEKEWYF  60
FCIRDKKYPT GQRTNRATEA GYWKATGKDK EIFRSKTLVG MKKTLVFYKG RAPRGEKTNW  120
VMHEYRLDGK YSVHNLPKSA QNECVICRVF KKTSGGKKIS ISSLIRNNNL TESPRSSNLP  180
PLMDMSPYNN QITTTTRSSG ETSNSHVTCF SDSMEDQKPQ THQPLACSPP SVDFPKYPSN  240
IPNQEPYIEN FQYVDSGLMQ DNSILRLLLE NNNYGSESKH NNHLRGYEDH NDFNINSAGP  300
VDLDCLWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-441315814171NO APICAL MERISTEM PROTEIN
1ut4_B3e-441315814171NO APICAL MERISTEM PROTEIN
1ut7_A3e-441315814171NO APICAL MERISTEM PROTEIN
1ut7_B3e-441315814171NO APICAL MERISTEM PROTEIN
3swm_A4e-441315817174NAC domain-containing protein 19
3swm_B4e-441315817174NAC domain-containing protein 19
3swm_C4e-441315817174NAC domain-containing protein 19
3swm_D4e-441315817174NAC domain-containing protein 19
3swp_A4e-441315817174NAC domain-containing protein 19
3swp_B4e-441315817174NAC domain-containing protein 19
3swp_C4e-441315817174NAC domain-containing protein 19
3swp_D4e-441315817174NAC domain-containing protein 19
4dul_A3e-441315814171NAC domain-containing protein 19
4dul_B3e-441315814171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019231923.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ21e-109NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1J6KUF80.0A0A1J6KUF8_NICAT; Nac domain-containing protein 100
STRINGXP_009768516.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-102NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]