PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04000g01030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 923aa    MW: 104954 Da    PI: 5.2167
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04000g01030.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS236.89.7e-7345275834347
                      GRAS  34 dgdpmqRlaayfteALaarlarsvselykal.ppsetsekn.....sseelaalklfsevsPilkfshltaNqaIleavegeerv 112
                               +++p+qRl +y+++AL++r+ r  ++ y    + ++    +      s + +a+ + +++ P+ ++ +++  q+Ile v +++++
  Niben101Scf04000g01030.1 452 SRNPVQRLSFYIAKALEERIDR-ATGRYTCTdEDRHL---KyiksmASGTNSAFLICHQLLPFSQVMQFAGVQTILENVRSAKKI 532
                               569*******************.33333222122222...122333455556666799*************************** PP

                      GRAS 113 HiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                               H iDf+i  G+QW  ++qaLa+++ +   l+iT+vgs   ++ke+ e tg+ L++fA++lg++f+f+++v ++++d++ e+ +++
  Niben101Scf04000g01030.1 533 HLIDFNIRSGIQWTVMMQALAEKS-EIELLKITAVGS---TEKEKFEVTGNTLHSFATSLGLSFSFDIVVLSDMKDFKKESVNIE 613
                               **********************95.569*********...579****************************************** PP

                      GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                                +E+laV +   l ++  ++  le+    ++k+v+s+ P+v+v+ e ea+hns+sFl+rf+e+l +y  +fd++e  + r+s  r
  Niben101Scf04000g01030.1 614 ADETLAVYCNTVLRTMIPKPDYLEN----LMKVVRSIGPTVIVIGEVEANHNSPSFLNRFIETLFFYGGFFDCFEDCMDRDSPCR 694
                               ****************977777777....******************************************************** PP

                      GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                               +++E  ++g+ i+n+va+eg+er+ r+ +le Wr+ ++++G+ + ++se+a  qa+l+l++++ +
  Niben101Scf04000g01030.1 695 RTIEGLYFGEGIRNIVAAEGKERFTRNVKLEVWRAFFSRFGMVEEEFSESAWYQANLILKQFA-Q 758
                               ************************************************************998.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.64381766IPR005202Transcription factor GRAS
PfamPF035143.4E-70452758IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    Send to blast
MGSSSEKWQG KKSLVSLMDC AANLLREPFQ FFTTILLSLL FPLSFLILSR LSIAHYLIDL  60
LGYSTEETDS DLLIKFFLHA NPTFLHILVS LVSVAALTHS LMGGTSCFIR RTAEPVSRPR  120
LYTAWIFLCI LQICVGLGIE DGHDLGDKRG FLARAIFFLG LHETMFFWSK TVVKPVVDDT  180
VFGVARENRL AEKAALAMSF GGLWWWRLRG EVESLVVVVE KKRDLLINIG LVDFVGWWLY  240
YLTVTIGLIK VVKSLIWVVY VMFGRRVVDT DNARDSVRND EKQICPGIGT MANVSNDNFT  300
GDHFRNELVV EDPWFEVELE DCADIDSVYS MCNEENTSNE QVTTNLFQDQ QQSISNWMQS  360
RFSTNTHQIQ SSIEQPKNDD FQPQVLQLIG NSTNEKSIPF SLASFELLNN YGRLIKKSSE  420
ENLSINNALS CETRASEEVN NQQFHLARKL TSRNPVQRLS FYIAKALEER IDRATGRYTC  480
TDEDRHLKYI KSMASGTNSA FLICHQLLPF SQVMQFAGVQ TILENVRSAK KIHLIDFNIR  540
SGIQWTVMMQ ALAEKSEIEL LKITAVGSTE KEKFEVTGNT LHSFATSLGL SFSFDIVVLS  600
DMKDFKKESV NIEADETLAV YCNTVLRTMI PKPDYLENLM KVVRSIGPTV IVIGEVEANH  660
NSPSFLNRFI ETLFFYGGFF DCFEDCMDRD SPCRRTIEGL YFGEGIRNIV AAEGKERFTR  720
NVKLEVWRAF FSRFGMVEEE FSESAWYQAN LILKQFAQGI MEDSADIQNF YTNYGFYQEY  780
AVNPQVQEMN KQQEEMNVYA VTPHVQTGSH VDKTPFLSLA PFELLRNNPS RCKNTEGDKV  840
RDMDNTTNAY QKLSAMQIMR LAGERFIQFS SNKSININNL LHPYGSALSN LSQEDNQDVE  900
LAQILLAAAE KVLTNNMTAQ GKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-364257535340GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019263178.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A3Q7EHN30.0A0A3Q7EHN3_SOLLC; Uncharacterized protein
STRINGSolyc01g079370.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-37RGA-like 1