PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03969g05020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 96aa    MW: 10542.8 Da    PI: 6.4989
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03969g05020.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.12.4e-1314061100
                    DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                               +vyeA+ar+rdPvyG+vg i++lqqq++ l+++la++++e
  Niben101Scf03969g05020.1   1 MVYEANARVRDPVYGCVGAISSLQQQIDMLRTQLAMAQAE 40 
                               69*********************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031955.9E-11138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.57141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MVYEANARVR DPVYGCVGAI SSLQQQIDML RTQLAMAQAE VVHLRLRQSA GITNSPTNSG  60
SPSSHIMGSH QPKGFFHMDL DVDQSNNGFN EPVWPC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609750.16e-66PREDICTED: LOB domain-containing protein 4-like
RefseqXP_019246176.12e-65PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-19LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A1J6IHI24e-64A0A1J6IHI2_NICAT; Lob domain-containing protein 4
STRINGXP_009783465.11e-64(Nicotiana sylvestris)
STRINGXP_009609750.12e-65(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.17e-21LOB domain-containing protein 4