PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03941g01012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 359aa    MW: 40999.1 Da    PI: 9.1883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03941g01012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.86.6e-302710351128
                       NAM  51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey +
  Niben101Scf03941g01012.1  27 VVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS-GSNMIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 103
                               446789**************************************.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.1071121IPR003441NAC domain
SuperFamilySSF1019411.19E-3423120IPR003441NAC domain
PfamPF023657.1E-1525102IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEDGDVSDDN KARKIIERSE NIYDKSVVQS DNEWFFFSPR GRKYPNGSQS KRATESGYWK  60
ATGKERNVKS GSNMIGTKRT LVFHTGRAPK GQRTQWIMHE YCMTENSYYQ DSVVVCRLRK  120
NNEFHLNDTH GNRRNHLAND CATALSGAGQ LDSLDLINGG YCCSKEGSSS FSSHSVDKIE  180
SGSESNKLTK ELPQHHSSSH WKDCDEDDCF ADIMKDDIVK LDDSSYKARH NLFPLVTRKL  240
ESSTKSSTQE FQDLMSPRLP FQGTANRRLR LQTEIVPRRV ERSEAYEANK KNSRAEGTRR  300
HLMINIIPVR RLKQWSIPLL LVSLALLVIF LCLFGVSQQV KWLTHLHVIT PAEVNTRPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-263012272169NAC domain-containing protein 19
3swm_B7e-263012272169NAC domain-containing protein 19
3swm_C7e-263012272169NAC domain-containing protein 19
3swm_D7e-263012272169NAC domain-containing protein 19
3swp_A7e-263012272169NAC domain-containing protein 19
3swp_B7e-263012272169NAC domain-containing protein 19
3swp_C7e-263012272169NAC domain-containing protein 19
3swp_D7e-263012272169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787917.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLA0A1U7X7410.0A0A1U7X741_NICSY; NAC domain-containing protein 89-like
STRINGXP_009787917.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.14e-55NAC domain containing protein 60