PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03839g12004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 294aa    MW: 32351.7 Da    PI: 9.0595
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03839g12004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.65.8e-40531521100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCaaCk++rr+Ca+dC+lapyfpae++k+f n+hklFG+sn+lk+lk++p+ ++++am++l++eA++ra+dPv G+++vi++l++
  Niben101Scf03839g12004.1  53 ACAACKYQRRRCAPDCPLAPYFPAERQKDFLNAHKLFGVSNILKVLKNVPPFQKDNAMKALIFEANIRADDPVGGCHRVIQNLHR 137
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q++  +a+l+l+ ++
  Niben101Scf03839g12004.1 138 QINIYQAQLQLVYHQ 152
                               **********99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.07652153IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3853149IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTNVVNNTQN ISSSATTSAV TTSTGVRSNP KNITRVASRG GDSSGRGANG SQACAACKYQ  60
RRRCAPDCPL APYFPAERQK DFLNAHKLFG VSNILKVLKN VPPFQKDNAM KALIFEANIR  120
ADDPVGGCHR VIQNLHRQIN IYQAQLQLVY HQIVRVQEAA IQEQQNFNTM TSVRGIDSNL  180
NFDMLPLHGL HGFNRSDFIC LGEAGSSSQI VKGKGVERIN NVEEFEVKTM MTHSNGKQPL  240
VESEDIKPYI KPYFGSIHTS KGKGVATELS QDTRMLSCEE PNVLNVAMLT SINL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-285415512113LOB family transfactor Ramosa2.1
5ly0_B5e-285415512113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785905.11e-162PREDICTED: uncharacterized protein LOC104234106
TrEMBLA0A1U7XHF71e-161A0A1U7XHF7_NICSY; uncharacterized protein LOC104234106
STRINGXP_009785905.11e-162(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA142941012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-40LOB domain-containing protein 22