PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03755g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 287aa    MW: 31721.1 Da    PI: 8.3285
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03755g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.4e-18207241135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C +Cg+ +Tp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf03755g00006.1 207 CKHCGSETTPQWRTGPMGPKTLCNACGVRYKSGRL 241
                               *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.50.102.4E-14200238IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.954201237IPR000679Zinc finger, GATA-type
SMARTSM004012.7E-17201251IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-14202264No hitNo description
CDDcd002022.71E-13206253No hitNo description
PfamPF003201.4E-15207241IPR000679Zinc finger, GATA-type
PROSITE patternPS003440207232IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
METPDCAAAG YFAHSIDYQF EHKPFDSTNN NKNNNHITVD DLLDFNKENE VMTDAFFDTI  60
TGANSADSSS LTVVDGCNSL VSGGEGHFDG NLSYRSFTKA PFLSSELCVP LIPVTEAPSS  120
TTTSTNNSSY RTVISSRNYH NITGSNSTPA FPCKSRSKRS SAAPFDWSSR ILLLPPTTAS  180
SLDSNSSLKT TPCRMRERTD TNTGRKCKHC GSETTPQWRT GPMGPKTLCN ACGVRYKSGR  240
LVPEYRPAAS PTFVSTEHSN SHRKVIEIRR QKELRTNQAH QQQLQMW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631558.11e-161PREDICTED: GATA transcription factor 9-like
TrEMBLA0A0V0HX752e-86A0A0V0HX75_SOLCH; Putative GATA transcription factor 12-like
STRINGSolyc03g120890.2.13e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.19e-50GATA transcription factor 9