PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03614g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 304aa    MW: 33508.4 Da    PI: 9.0205
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03614g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.16.5e-20201234134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               C++C++tkTp+WR+gp g+ktLCnaCG++yr+ +
  Niben101Scf03614g00004.1 201 CTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGR 234
                               *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.5E-15195245IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.517195231IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.5E-14200232IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577168.08E-15200258No hitNo description
CDDcd002021.40E-16200247No hitNo description
PfamPF003201.1E-17201234IPR000679Zinc finger, GATA-type
PROSITE patternPS003440201226IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MTMVGHCGYF DGIPTGPVVD EDFDDILNFL DFPLESLEED GQGVEWDASE SKFLGPIPTD  60
ALMAFPLVPQ GNIGNGRVKA EPNSNHPIKI TEGQGSGIFQ TQSPVSVLES SNSCSGGKSI  120
SIKHDIVIPV RPRSKRPRSS ALNPWILMPP ISSTRFASKK TCDARKGKEK KRKMSLLSVP  180
QIADVTKKKT TSAQQFSLKK CTHCQVTKTP QWREGPLGPK TLCNACGVRY RSGRLFPEYR  240
PAASPTFVPT LHSNSHRKVV EMRKKAIYGE TSTLEEPHYV IVEGPPMSPA PEFVPMSSYL  300
FDVY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795845.10.0PREDICTED: GATA transcription factor 11-like isoform X1
RefseqXP_016514725.10.0PREDICTED: GATA transcription factor 11-like isoform X1
TrEMBLQ9AVU30.0Q9AVU3_TOBAC; GATA-1 zinc finger protein
STRINGPGSC0003DMT4000208761e-159(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31342149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.23e-44GATA transcription factor 11