PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03548g01010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LFY
Protein Properties Length: 415aa    MW: 46337.1 Da    PI: 6.5225
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03548g01010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY646.34.4e-19713951386
                   FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap.........leaaaaaaarklr.....eleelfkayGvryltvakiael 71 
                               mdpe+fsaslfkwdpr a+ +pp+rl+e a+++++p         +     +aa+++r     +leelf+ayG+ry+t+akiael
  Niben101Scf03548g01010.1   1 MDPEDFSASLFKWDPRGAM-PPPTRLMEAAVAPPPPplalpqpqpM-----SAAYSIRtrelgGLEELFQAYGIRYYTAAKIAEL 79 
                               9**************9876.77889988888777667777443333.....444444444555********************** PP

                   FLO_LFY  72 GftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqe 156
                               Gftv+tL+dmkdeeldd+m+sls+ifr++llvGeryGikaa+raerrrleeee  ++r +lls+  ++aldalsqeglseepvq+
  Niben101Scf03548g01010.1  80 GFTVNTLLDMKDEELDDMMNSLSQIFRWELLVGERYGIKAAIRAERRRLEEEE-LRRRGHLLSDGGTNALDALSQEGLSEEPVQQ 163
                               ***************************************************88.8888899999999****************99 PP

                   FLO_LFY 157 .ekeaagsggeglgeaelvaaee..kkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtep 238
                                e+ea+gsgg+g +++e+v a+   + +++++kk   + ++r+   +++++e+++e +e+d + +++g + +erqrehPfivtep
  Niben101Scf03548g01010.1 164 qEREAVGSGGGG-TTWEVVEAAGggRMKQRRRKKVVVAGRERRGGASAEEDEETEEGQEDDWNINDAGGGLSERQREHPFIVTEP 247
                               456677777766.88998887764334444444444443334444443444555555555566667777778************* PP

                   FLO_LFY 239 gevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalr 323
                               gevargkknGLDYLf+LyeqCr+fL+qvq+iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalr
  Niben101Scf03548g01010.1 248 GEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALR 332
                               ************************************************************************************* PP

                   FLO_LFY 324 rafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                               rafkergenvGawrqacykplvaiaarqgwdid++fnahprL+iWYvPtkLrqLCh er++a+
  Niben101Scf03548g01010.1 333 RAFKERGENVGAWRQACYKPLVAIAARQGWDIDTIFNAHPRLAIWYVPTKLRQLCHSERTNAA 395
                               ***********************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.3E-2091395IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MDPEDFSASL FKWDPRGAMP PPTRLMEAAV APPPPPLALP QPQPMSAAYS IRTRELGGLE  60
ELFQAYGIRY YTAAKIAELG FTVNTLLDMK DEELDDMMNS LSQIFRWELL VGERYGIKAA  120
IRAERRRLEE EELRRRGHLL SDGGTNALDA LSQEGLSEEP VQQQEREAVG SGGGGTTWEV  180
VEAAGGGRMK QRRRKKVVVA GRERRGGASA EEDEETEEGQ EDDWNINDAG GGLSERQREH  240
PFIVTEPGEV ARGKKNGLDY LFHLYEQCRD FLIQVQNIAK ERGEKCPTKV TNQVFRYAKK  300
AGASYINKPK MRHYVHCYAL HCLDEEASNA LRRAFKERGE NVGAWRQACY KPLVAIAARQ  360
GWDIDTIFNA HPRLAIWYVP TKLRQLCHSE RTNAAAASSS VSGGGGGVGD HLPHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1112344123192PROTEIN LEAFY
2vy2_A1e-1112344123192PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that act to specify determinacy in the progenitor cells for both flowers and leaves.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019231654.10.0PREDICTED: floricaula/leafy homolog 2
SwissprotQ405050.0FL2_TOBAC; Floricaula/leafy homolog 2
TrEMBLA0A1S3YBE10.0A0A1S3YBE1_TOBAC; floricaula/leafy homolog 2
TrEMBLA0A1U7X1290.0A0A1U7X129_NICSY; floricaula/leafy homolog 2 isoform X2
STRINGXP_009780578.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-147floral meristem identity control protein LEAFY (LFY)