PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03427g10002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 483aa    MW: 54061.2 Da    PI: 6.0383
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03427g10002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ411.22e-1262044231217
                       VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipeceg 82 
                               pp saflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg pg  pv+rp gi+lkd+llf+al ak++gk+vg+peceg
  Niben101Scf03427g10002.1 204 PPASAFLGPKCALWDCPRPAMGSDWCpksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALGAKAHGKDVGVPECEG 288
                               789**********************87779******************************************************* PP

                       VOZ  83 aatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfew 167
                               aatakspwna+elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ew
  Niben101Scf03427g10002.1 289 AATAKSPWNAPELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEW 373
                               ************************************************************************************* PP

                       VOZ 168 hlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                               hlyeyein++da+alyrlelklvd+kk +kgk+++ s++dlqk++grlta
  Niben101Scf03427g10002.1 374 HLYEYEINKYDACALYRLELKLVDGKKIPKGKITNVSVSDLQKQMGRLTA 423
                               ************************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MRKVSKRGAC KSASHQLFKD RAKNRVDDLQ GVLTNLQSAR KESRSYDVGL LEEQVHQMLR  60
EWKAELNEPS PASSLQARTN TFGGSLVSSS DIYRLLLGEE EDDATSALAA PKPEPDAQKV  120
SVTGFQEGFN ATQVLQEQGF HLVDQCKGLP LVVNNSGINN LGIATQLDYH SFDLHQEYDQ  180
QYLPGFDALY LCLEDALPPI HISPPASAFL GPKCALWDCP RPAMGSDWCP KSQDYCSDYH  240
ASLAPNEGYP GRPPVVRPMG IGLKDNLLFQ ALGAKAHGKD VGVPECEGAA TAKSPWNAPE  300
LFDLKVVEGE TIREWLFFDK PRRAFESGNR KQRSLPDYNG RGWHESRKQM MNEFGGLKRS  360
YYMDPQPMKN LEWHLYEYEI NKYDACALYR LELKLVDGKK IPKGKITNVS VSDLQKQMGR  420
LTAEFPLDNK RTVKGRAKAA ILKNVGNIQA APIPMLPTCE EFDYGTGEPY DYLVDDLDGY  480
FIT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019235319.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_019235320.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_019235321.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1J6K8180.0A0A1J6K818_NICAT; Transcription factor voz1
STRINGXP_009780205.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]