PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03412g01020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 137aa    MW: 15322.7 Da    PI: 8.2313
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03412g01020.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.11.7e-39111066101
                    DUF260   6 kvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                                +lrr+CakdC++apyf +++p++fa+vhk+FGasn++k+l+++p ++r da+ss+vyeA+ r+rdPvyG+vg i  lq+q++ql
  Niben101Scf03412g01020.1  11 HLLRRRCAKDCIFAPYFSSDDPHQFAIVHKVFGASNISKMLQEVPVNKRADAVSSIVYEANTRMRDPVYGCVGAIYYLQNQVSQL 95 
                               679********************************************************************************** PP

                    DUF260  91 kaelallkeel 101
                               + +lal+++e+
  Niben101Scf03412g01020.1  96 QMQLALAQAEI 106
                               ******99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.8565106IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-3912103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MGATGNSHVL HLLRRRCAKD CIFAPYFSSD DPHQFAIVHK VFGASNISKM LQEVPVNKRA  60
DAVSSIVYEA NTRMRDPVYG CVGAIYYLQN QVSQLQMQLA LAQAEILCIQ MQSSQHHQPV  120
NLLPMSPPIH DQISSCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-3821077112LOB family transfactor Ramosa2.1
5ly0_B6e-3821077112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604707.12e-76PREDICTED: LOB domain-containing protein 12-like
RefseqXP_009764881.12e-76PREDICTED: LOB domain-containing protein 12-like
RefseqXP_016435041.12e-76PREDICTED: LOB domain-containing protein 12-like
RefseqXP_016437290.12e-76PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW37e-62LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1S3X5C45e-75A0A1S3X5C4_TOBAC; LOB domain-containing protein 12-like
TrEMBLA0A1S3XBI34e-75A0A1S3XBI3_TOBAC; LOB domain-containing protein 12-like
TrEMBLA0A1U7VIX64e-75A0A1U7VIX6_NICSY; LOB domain-containing protein 12-like
STRINGXP_009764881.16e-76(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-56LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]